g21284.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg21284.t1
Unique Nameg21284.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length299
Homology
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861633882|gb|KMQ91095.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 327.4 bits (838), Expect = 6.100e-86
Identity = 145/252 (57.54%), Postives = 200/252 (79.37%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRNPLP+ +LI E++D + IRL +AQ +DEE++K++ + +  +   +V+R  LL+ E+D+D  +VVPK+M  Q++R+AHERGHF V KTE I+++D++ +N+R KVEK++ NC++CILAE+KQGK+ GFL+ I KG+VPLDT+H+DH+GP+T T+K Y+++FVVVD F+KF WLY TKST   EV+DRL KQ+ +FGNPRRIISDRG AFTS  F+EYC  E + H L TTG+PR NGQ+ RV R
Sbjct:  803 MSHVDALSRNPLPACLLIDESDDEITIRLRKAQNDDEEIRKIIQQTDDGKTHDYVIRGGLLFKEIDDDYCLVVPKAMHSQIIRRAHERGHFSVAKTEAIIKRDYYIQNLRSKVEKIIRNCIDCILAEKKQGKQEGFLSVIGKGEVPLDTFHVDHLGPLTSTKKNYKYIFVVVDGFSKFAWLYTTKSTSTAEVVDRLKKQATVFGNPRRIISDRGTAFTSGDFQEYCRHEGIQHILTTTGIPRANGQVERVNR 1054          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861633883|gb|KMQ91096.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 327.4 bits (838), Expect = 6.100e-86
Identity = 145/252 (57.54%), Postives = 200/252 (79.37%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRNPLP+ +LI E++D + IRL +AQ +DEE++K++ + +  +   +V+R  LL+ E+D+D  +VVPK+M  Q++R+AHERGHF V KTE I+++D++ +N+R KVEK++ NC++CILAE+KQGK+ GFL+ I KG+VPLDT+H+DH+GP+T T+K Y+++FVVVD F+KF WLY TKST   EV+DRL KQ+ +FGNPRRIISDRG AFTS  F+EYC  E + H L TTG+PR NGQ+ RV R
Sbjct: 1029 MSHVDALSRNPLPACLLIDESDDEITIRLRKAQNDDEEIRKIIQQTDDGKTHDYVIRGGLLFKEIDDDYCLVVPKAMHSQIIRRAHERGHFSVAKTEAIIKRDYYIQNLRSKVEKIIRNCIDCILAEKKQGKQEGFLSVIGKGEVPLDTFHVDHLGPLTSTKKNYKYIFVVVDGFSKFAWLYTTKSTSTAEVVDRLKKQATVFGNPRRIISDRGTAFTSGDFQEYCRHEGIQHILTTTGIPRANGQVERVNR 1280          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861617639|gb|KMQ86633.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 326.2 bits (835), Expect = 1.400e-85
Identity = 153/252 (60.71%), Postives = 194/252 (76.98%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRNPLP+ ++I+E   GL+ RL +AQ  D+EL+      E+ +++G+V+R  +LY E D DI +VVPK+MQ QV+++AHE+GHFG+ KTE + R+D+W  N+R KVE V+ NCV+CILAERK GK   FLN I KGDVPLDT+HID++GP+  T+K Y H+FVVVDAF+KFVWLY TKST A E I+RL KQS  FGNPRRI+SDRG AFTS  F+EYC SE ++H L TTGVPR NGQ+ RV R
Sbjct:  912 MTHVDALSRNPLPTCLIISECERGLLARLKKAQNADDELKGTFEAIEQDRSEGYVIRGGVLYKEDDGDIRLVVPKAMQSQVIKRAHEQGHFGIAKTEALTRRDYWIPNLRTKVESVLRNCVSCILAERKHGKAECFLNPIDKGDVPLDTFHIDYLGPLQSTKKSYAHIFVVVDAFSKFVWLYATKSTSAAEAIERLRKQSCTFGNPRRIVSDRGAAFTSREFEEYCRSENIEHQLTTTGVPRANGQVERVNR 1163          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|815822750|ref|XP_012232667.1| (PREDICTED: uncharacterized protein LOC105678149 [Linepithema humile])

HSP 1 Score: 321.6 bits (823), Expect = 3.300e-84
Identity = 145/252 (57.54%), Postives = 192/252 (76.19%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRNPLP+ +L+ E+   +  +L RAQ  D E+ +++  AE+ + +G+ +R+ LL+ +   D+ +VVPKSM  QV+RQAH RGHF   KTE I+++D+W  N+R K EKVV NC++CILAE+KQG++ GFLN I KGDVPLDT+H+DH+GP+  T+K Y+H+FVV+D+FTKF WLY TKST   EVID+L KQS +FGNPRR++SDRG AFTSN FKEYC  E + H L TTG+PR NGQ+ RV R
Sbjct:  884 MAHVDALSRNPLPTCLLVDEDESAVTAKLRRAQETDPEIMRVMWLAEQGKIEGYAIRDGLLFKDDGVDVRLVVPKSMAYQVIRQAHARGHFAAGKTEAIVKRDYWIANLRGKTEKVVCNCIDCILAEKKQGRQEGFLNTIDKGDVPLDTFHVDHLGPLASTKKNYRHIFVVIDSFTKFTWLYTTKSTSTAEVIDKLRKQSIIFGNPRRVVSDRGTAFTSNDFKEYCQRENIQHVLTTTGIPRANGQVERVNR 1135          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861598320|gb|KMQ83465.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 321.2 bits (822), Expect = 4.400e-84
Identity = 146/253 (57.71%), Postives = 194/253 (76.68%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDN-DIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRNP PS +LI E++D LI R  +AQ+ED ELQK    +     +G ++ N+LLY E +N ++ +VVPK+MQ QV+RQAHE GHF  +KTEL++++++WFK MR K+EK++ NC+ CILAE+K GKR GFLN I KG+VPL TYH+DH+GP+  T+K Y+H+FV+VDAF+KFVWLY T++T   EV+DR+ KQ+ +FGNP RII DRG AFTS  F+ YC  +K++H LITTG+PR NGQ  RV R
Sbjct:    1 MLHVDALSRNPFPSCLLINEDSDSLIFRFRKAQQEDSELQKFFRTSGDQATEGFIIENNLLYKEDNNRELRLVVPKTMQSQVIRQAHENGHFAADKTELLLKRNYWFKGMRPKIEKIIQNCITCILAEKKHGKREGFLNPINKGEVPLHTYHVDHLGPLASTKKSYRHIFVIVDAFSKFVWLYATRTTGTTEVLDRMKKQAIVFGNPLRIILDRGSAFTSGDFENYCKEQKIEHILITTGLPRANGQAERVNR 253          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861617614|gb|KMQ86624.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 316.6 bits (810), Expect = 1.100e-82
Identity = 146/252 (57.94%), Postives = 193/252 (76.59%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSR+PLPS ++I+E  +GL+ RL +AQRED +L+K+    ER + + +VVR+ +LY + D DI +VVP++M+ QV+R+AHE+GHFGV KTE ++RKD+W   +R +VEKV+ NC+ CILAERK G+   FL+ I KG VPLDT+HID++GP+  T+K Y H+FV+VD F+KF WLY TKS  A+E I RL +QS +F NPRRI+SDRG AFTS  F+EYC SE + H LITTGVPR NGQ+ RV R
Sbjct:  190 MVHVDALSRSPLPSCLVISECEEGLLARLRKAQREDSDLKKIADAIERGEPNNYVVRSGILYKDADGDIRVVVPRAMRRQVIRKAHEQGHFGVGKTEALLRKDYWIPGLRAEVEKVIKNCITCILAERKHGRSECFLSPIEKGSVPLDTFHIDYLGPLPSTKKSYVHIFVMVDGFSKFTWLYATKSASAMEAIGRLKRQSCIFANPRRIVSDRGSAFTSGEFEEYCRSEGISHQLITTGVPRANGQVERVNR 441          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861624022|gb|KMQ88158.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 313.5 bits (802), Expect = 9.100e-82
Identity = 147/252 (58.33%), Postives = 191/252 (75.79%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSR+PLP+ ML+ E  D ++ RL R Q +D+EL+ +  + E +QADG V+ N LL  EV+ D  IV+PK MQ  V+RQ HERGHFG  KTE +++ D+W KNM  KVE+V+ NC+ CI+A +K GK+ G+L+ I K + PLDTYH+DH+GPM  T+KKYQ++F +VDAFTKFVWLYPTKST+  EV++ L +QSA+FGNPRRIISD+G AFTSN FK YC  E ++H  I TG+PRGNGQI R+ R
Sbjct:  339 MRHVDALSRHPLPAAMLVEECEDSILARLRRNQLKDDELKNIRKQVEENQADGFVIVNGLLCKEVNGDTPIVIPKLMQTSVIRQIHERGHFGSAKTEQLLKSDYWIKNMHSKVERVIQNCLACIMAAKKTGKQEGWLHPIDK-ETPLDTYHVDHLGPMPSTQKKYQYIFAIVDAFTKFVWLYPTKSTNTTEVLNHLMRQSAIFGNPRRIISDQGSAFTSNDFKSYCEDEGIEHITIVTGIPRGNGQIERINR 589          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|861619777|gb|KMQ87102.1| (blastopia polyprotein [Lasius niger])

HSP 1 Score: 308.1 bits (788), Expect = 3.800e-80
Identity = 136/252 (53.97%), Postives = 192/252 (76.19%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            M HVDALSRN LP+ M+ITEN+D ++ +L + Q  D E+  +  + ER + + + ++N LL   ++ + +IV+P+ MQ  V+R+AHE+GHFG +KTE +++ ++WF  MR+K E V+ NC++CILAERK GK+ G+L+ I KG+ P DTYH+DH+GP+  T+K Y+H+FV+VDAF KF+WLYPTKST   EV+DRL +QSA+FGNPRRIISDRG AFTS+ F+ YC  E ++H+ I TG+PRGNGQ+ RV R
Sbjct:  945 MRHVDALSRNALPTAMIITENDDSILAKLRKQQENDLEIANLREQVERGRTEEYTLKNKLLCKNLNGETLIVIPELMQNSVIRRAHEQGHFGPDKTEKLIKMNYWFTGMRKKTEDVIQNCISCILAERKSGKKEGWLHPIPKGEKPFDTYHVDHLGPLPSTKKNYRHLFVIVDAFAKFIWLYPTKSTSTREVLDRLMQQSAIFGNPRRIISDRGTAFTSHEFRNYCEEENIEHSTIVTGLPRGNGQVERVNR 1196          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|780686746|ref|XP_011698713.1| (PREDICTED: uncharacterized protein LOC105456415 [Wasmannia auropunctata])

HSP 1 Score: 306.6 bits (784), Expect = 1.100e-79
Identity = 139/252 (55.16%), Postives = 187/252 (74.21%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRVMR 253
            +PHVDALSRNPL S  +I E+ +G I R  +A++ED +++K+   A + Q+  +++R  LL+ E   D  +VVPK MQ Q++R+AHE+GHF +NKTE+++R+D+W  N+R KVEKVV NC+ CILAERKQGK  G LN I KG +PLDT+H+DH+G +  T+K Y+H+ V+VDAF+KF WL+ TKST  VEV+  + K +A+FGNPRRIISDRG AFTS  F+EYC  E + H L T GVPR NGQ+ RV R
Sbjct:  328 VPHVDALSRNPLSSCFVIDESEEGFIARFRKAKKEDSDIKKICDLASQGQSSDYIIRGGLLFKEDAGDFRLVVPKVMQSQIIREAHEKGHFSINKTEILVRRDYWICNLRSKVEKVVRNCITCILAERKQGKLDGLLNPIEKGSLPLDTFHVDHLGSLPSTKKSYKHILVIVDAFSKFTWLFATKSTSTVEVLSCMRKLAAIFGNPRRIISDRGTAFTSKDFEEYCRQENIVHCLTTAGVPRSNGQVERVNR 579          
BLAST of g21284.t1 vs. GenBank_protein
Match: gi|1069666489|ref|XP_018308057.1| (PREDICTED: uncharacterized protein K02A2.6-like, partial [Trachymyrmex zeteki])

HSP 1 Score: 301.2 bits (770), Expect = 4.700e-78
Identity = 141/249 (56.63%), Postives = 186/249 (74.70%), Query Frame = 0
Query:    1 MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIMRKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTYHIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQSAMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITR 250
            M HVDALSR+PLP+ MLI E  D ++ +L   Q ED EL+ +  + E  +    +V N LL  ++D D+ IV+PK MQ  ++R+ H+RGHFG  KTE +++ D+WFK+M  KVEKV+ NC+ CI+A +K G++ G+L++I K D PLDTYHIDH+GPM  T+K+YQ++FV+VDAFTK+VWLYPTKST   EV+D L +QSA+FGNPRRIISD+G AFTSN FK YC  E + H LI TGVPRGNGQ+ R
Sbjct:  149 MRHVDALSRHPLPAAMLIEECEDSMMAKLRLNQSEDAELKDIRKQVEEGKTKKFIVENGLLCKKIDGDVPIVIPKLMQTPMIRRVHDRGHFGNAKTEQLLKSDYWFKDMHSKVEKVIQNCLECIMAAKKMGRQEGWLHSIEK-DAPLDTYHIDHLGPMLSTQKRYQYIFVIVDAFTKYVWLYPTKSTGVTEVLDHLIQQSAVFGNPRRIISDQGSAFTSNDFKSYCADEGILHDLIVTGVPRGNGQVER 396          
The following BLAST results are available for this feature:
BLAST of g21284.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|861633882|gb|KMQ91095.1|6.100e-8657.54blastopia polyprotein [Lasius niger][more]
gi|861633883|gb|KMQ91096.1|6.100e-8657.54blastopia polyprotein [Lasius niger][more]
gi|861617639|gb|KMQ86633.1|1.400e-8560.71blastopia polyprotein [Lasius niger][more]
gi|815822750|ref|XP_012232667.1|3.300e-8457.54PREDICTED: uncharacterized protein LOC105678149 [L... [more]
gi|861598320|gb|KMQ83465.1|4.400e-8457.71blastopia polyprotein [Lasius niger][more]
gi|861617614|gb|KMQ86624.1|1.100e-8257.94blastopia polyprotein [Lasius niger][more]
gi|861624022|gb|KMQ88158.1|9.100e-8258.33blastopia polyprotein [Lasius niger][more]
gi|861619777|gb|KMQ87102.1|3.800e-8053.97blastopia polyprotein [Lasius niger][more]
gi|780686746|ref|XP_011698713.1|1.100e-7955.16PREDICTED: uncharacterized protein LOC105456415 [W... [more]
gi|1069666489|ref|XP_018308057.1|4.700e-7856.63PREDICTED: uncharacterized protein K02A2.6-like, p... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015074 DNA integration
biological_process GO:0006508 proteolysis
molecular_function GO:0004190 aspartic-type endopeptidase activity
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 29..52
NoneNo IPR availableGENE3D1.10.340.70coord: 36..127
e-value: 1.8E-16
score: 62.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 262..299
NoneNo IPR availablePANTHERPTHR24559:SF275coord: 5..250
NoneNo IPR availablePANTHERPTHR24559FAMILY NOT NAMEDcoord: 5..250
IPR036397Ribonuclease H superfamilyGENE3D3.30.420.10coord: 140..280
e-value: 4.2E-30
score: 106.4
IPR001584Integrase, catalytic corePFAMPF00665rvecoord: 146..252
e-value: 1.3E-17
score: 64.1
IPR001584Integrase, catalytic corePROSITEPS50994INTEGRASEcoord: 142..299
score: 20.299
IPR041588Integrase zinc-binding domainPFAMPF17921Integrase_H2C2coord: 73..126
e-value: 1.0E-17
score: 64.0
IPR012337Ribonuclease H-like superfamilySUPERFAMILY53098Ribonuclease H-likecoord: 141..271

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_3948contigscaffold_3948:3125..4447 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g21284.t1g21284.t1Venturia canescensmRNAscaffold_3948 3125..4447 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g21284.t1-PA ID=g21284.t1-PA|Name=g21284.t1|organism=Venturia canescens|type=polypeptide|length=299bp
MPHVDALSRNPLPSVMLITENNDGLIIRLMRAQREDEELQKMLSEAERSQ
ADGHVVRNDLLYTEVDNDIVIVVPKSMQMQVVRQAHERGHFGVNKTELIM
RKDFWFKNMRQKVEKVVNNCVNCILAERKQGKRGGFLNAILKGDVPLDTY
HIDHVGPMTVTRKKYQHVFVVVDAFTKFVWLYPTKSTDAVEVIDRLSKQS
AMFGNPRRIISDRGVAFTSNAFKEYCTSEKMDHTLITTGVPRGNGQITRV
MRNDRYMVERVGEQEGPRQTPTAADQMKPWGVNTYPDDTEDDDSESEDI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO:0015074DNA integration
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR001584Integrase_cat-core
IPR041588Integrase_H2C2
IPR012337RNaseH-like_sf