g21287.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg21287.t1
Unique Nameg21287.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length246
Homology
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|1465635523|ref|XP_011171526.2| (uncharacterized protein LOC105204165 isoform X1 [Solenopsis invicta])

HSP 1 Score: 148.7 bits (374), Expect = 3.200e-32
Identity = 84/234 (35.90%), Postives = 144/234 (61.54%), Query Frame = 0
Query:    5 DGIDALKELEKNVNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDITERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVDDEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMPLFTVQEHLSSTTDLNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIRPVTKLKPSV-QKFMRDCE 238
            D  +ALKELEK     +  H++ LL+ ++ +RR+WI+N++  I +I ++YP L+   +++FEF  + S+ EE    KI+ M+ K   YF  + A  D+ S+  +L +L   L    + KK  K+ +M LF ++E L ST DL + E+ +PR V+Y  ++ I++AY+VAD ++++KI  P+V   +  L++ Y+ W +  P +Y N L+Y+E EI+    K + +V  KF+RDC+
Sbjct:  329 DITNALKELEKKFMENNASHIKRLLKITMPVRRQWIENKSNRINEIVKKYPSLQYYEMLLFEFFNMKSITEETFFEKIDVMINKQIQYFSIKEA--DQISQVQILERLQKEL----IYKKCKKRYSM-LFIIKEVLCSTEDLTTSEKEAPRAVIYMTNEEIASAYIVAD-EIKVKIPQPTVHKVIAGLLSGYYVWHMECPKSYANILEYMEHEILSTSLKSRSTVLMKFVRDCD 554          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|1009401543|gb|KYN21450.1| (hypothetical protein ALC57_06176, partial [Trachymyrmex cornetzi])

HSP 1 Score: 143.3 bits (360), Expect = 1.300e-30
Identity = 86/240 (35.83%), Postives = 137/240 (57.08%), Query Frame = 0
Query:    8 DALKELEKN-VNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDITERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVDDEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMPLFTVQEHLSSTTDLNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIR-PVTKLKPSVQKFMRDCEMKFQANNS 246
            + LKELEK  VN+ +  H++ LL+ +++ RR WI +EAK I DI ++YPQL    LI+ EF  L  + EE +  +I +M+EKL  Y+          +KA +L  L   L       +   K+   LF VQE +  T +L   E+ + R+V+YT D+ I+ AYLVADA+++I+I  P++   +  L ASY+ W+  +P AY N L +L  E+ + P+     +++KF+R  +     NN+
Sbjct:   91 NVLKELEKKFVNYNNISHIKYLLKITISHRRPWI-DEAKRIIDIVQKYPQLNNYELILSEFLELKKITEEALFNEIKKMIEKLTKYYSVR---KSNNNKAFVLQNLCVDLAI-----RTRNKNTPALFIVQEVMGDTNNLTINEDDALRVVIYTNDQDITIAYLVADAEIKIQIPQPTLEKIIAGLFASYYVWNRTFPAAYVNVLNFLNYELFKFPLPNTATTIKKFIRSRDNILNLNNA 321          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|1009411037|gb|KYN30068.1| (hypothetical protein ALC57_00473 [Trachymyrmex cornetzi])

HSP 1 Score: 135.2 bits (339), Expect = 3.700e-28
Identity = 83/228 (36.40%), Postives = 135/228 (59.21%), Query Frame = 0
Query:    9 ALKELEKN-VNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDITERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVDDEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMP-LFTVQEHLSSTTDLNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIR-PVTKLKPSVQKFM 234
            ALKELEK  V+H +  H++ LL+ +++ RR WI +EAK I DI ++YPQL    LI+ EF  L  + EE +   I +M+ KL  Y+  +   ++  ++A ++  L   LT +        K N P LFTV+E +  T +L + E+ +PR+V+Y   + I+ AYLVADA++RI+I  P++   +  L ASY+ W+  +P AY N L ++  E+   P+     +++KF+
Sbjct:  286 ALKELEKKFVDHKNISHMKHLLKMTISHRRPWI-DEAKRIIDIVQKYPQLNNYELILSEFLQLKKITEETLFNGIKKMIGKLTKYYTVKKPTNN--NEAFVIQNLCADLTIR------KNKKNFPALFTVKEIMGDTDNLITNEDDAPRVVMYIDGQDITIAYLVADAEIRIQIPQPTMEKIIAGLFASYYVWNRTFPAAYVNVLNFINYELFNSPLPTTSTTIKKFI 504          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|795015269|ref|XP_011858093.1| (PREDICTED: uncharacterized protein LOC105555677 [Vollenhovia emeryi])

HSP 1 Score: 101.7 bits (252), Expect = 4.500e-18
Identity = 60/138 (43.48%), Postives = 82/138 (59.42%), Query Frame = 0
Query:    1 QDDVDGIDALKELEKNVNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDITERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVDDEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMPLFTVQE 139
            Q D D   ALKEL+K  N++DTPHVR LL  +  +RR WI+ EA  I+ I  +YPQL +  LIIFEF TL  +  E +   +N M+ KL+ ++C   A+  E SKA +L +L   L  K +     KK+  PLF V+E
Sbjct:   19 QTDSDTEAALKELDKKCNNVDTPHVRRLLYETFIVRRSWIEKEATEISSIVAKYPQLAVYDLIIFEFITLKKITLETLLENVNAMIGKLSAHYCANEAI-TEKSKASVLVKLHEELANKKI-----KKTVNPLFIVKE 150          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|1387120255|ref|XP_024868231.1| (uncharacterized protein LOC112452328 [Temnothorax curvispinosus])

HSP 1 Score: 86.3 bits (212), Expect = 1.900e-13
Identity = 39/102 (38.24%), Postives = 68/102 (66.67%), Query Frame = 0
Query:  140 LSSTTDLNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIRPVTKLKPSVQKFMRDCEMKFQ 242
            ++ST +L   +  SPR+VLYT ++ +++A++VAD  +R+KI  P+V+  V CL+ASY+ WD  YP AY N + +++ +++  V+K    +QKF+R    K +
Sbjct:    2 MASTENLIGAKGDSPRVVLYTAEEGVASAFVVADTNIRVKIPEPTVTKTVICLLASYYVWDTTYPLAYSNVMGFIDYKVLGTVSK-NQRIQKFIRKLNHKLE 102          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|1465635525|ref|XP_025997041.1| (uncharacterized protein LOC105204165 isoform X2 [Solenopsis invicta])

HSP 1 Score: 78.6 bits (192), Expect = 4.100e-11
Identity = 38/99 (38.38%), Postives = 65/99 (65.66%), Query Frame = 0
Query:  140 LSSTTDLNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIRPVTKLKPSV-QKFMRDCE 238
            L ST DL + E+ +PR V+Y  ++ I++AY+VAD ++++KI  P+V   +  L++ Y+ W +  P +Y N L+Y+E EI+    K + +V  KF+RDC+
Sbjct:  388 LCSTEDLTTSEKEAPRAVIYMTNEEIASAYIVAD-EIKVKIPQPTVHKVIAGLLSGYYVWHMECPKSYANILEYMEHEILSTSLKSRSTVLMKFVRDCD 485          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|815793490|ref|XP_012217364.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105669151 [Linepithema humile])

HSP 1 Score: 76.6 bits (187), Expect = 1.500e-10
Identity = 33/69 (47.83%), Postives = 50/69 (72.46%), Query Frame = 0
Query:  167 TAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWDVAYPPAYENTLQYLESEIIRPVTKLKPSVQKFMRD 236
            TAY+VAD + R+KI  PSV  ++ CL+ASY+ WD  YP AY+N ++Y++ E++  V K  P++ KF+RD
Sbjct:  167 TAYVVAD-EFRMKIVEPSVCKSIACLLASYYIWDTNYPKAYKNAMEYIDHEVLGTVMKENPTIDKFIRD 234          
BLAST of g21287.t1 vs. GenBank_protein
Match: gi|795018722|ref|XP_011859326.1| (PREDICTED: uncharacterized protein LOC105556826 isoform X1 [Vollenhovia emeryi])

HSP 1 Score: 73.9 bits (180), Expect = 1.000e-9
Identity = 53/181 (29.28%), Postives = 96/181 (53.04%), Query Frame = 0
Query:    7 IDALKELEKNVNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDITERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVDDEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMPLFTVQEHLSSTTD-LNSVEEASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVS 187
            ++ LK L + V    TPHV+ L++ +   R++ I N + SI  +   +P L  + +I+FEF   +++   ++  + N ++ +L  +       + E  K ++L +L+     K   KK  +     LFTV++ LS   D L + E   PR+V Y ++  I+ A++VAD + RIKI+ PS +
Sbjct:   25 MEELKTLTEKVGL--TPHVKALMKETFINRKRIIDN-SDSIKTVVSNFPFLLDTEMILFEFSLRVNLKVNDIIQRNNALIIELGSFLKVPEDTNSENRKLNILEKLYLNYKPKRTAKKVPQ-----LFTVKDALSPPGDELVTKETEGPRLVTYVENNVITAAFVVADGK-RIKINKPSTT 196          
The following BLAST results are available for this feature:
BLAST of g21287.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 8
Match NameE-valueIdentityDescription
gi|1465635523|ref|XP_011171526.2|3.200e-3235.90uncharacterized protein LOC105204165 isoform X1 [S... [more]
gi|1009401543|gb|KYN21450.1|1.300e-3035.83hypothetical protein ALC57_06176, partial [Trachym... [more]
gi|1009411037|gb|KYN30068.1|3.700e-2836.40hypothetical protein ALC57_00473 [Trachymyrmex cor... [more]
gi|795015269|ref|XP_011858093.1|4.500e-1843.48PREDICTED: uncharacterized protein LOC105555677 [V... [more]
gi|1387120255|ref|XP_024868231.1|1.900e-1338.24uncharacterized protein LOC112452328 [Temnothorax ... [more]
gi|1465635525|ref|XP_025997041.1|4.100e-1138.38uncharacterized protein LOC105204165 isoform X2 [S... [more]
gi|815793490|ref|XP_012217364.1|1.500e-1047.83PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|795018722|ref|XP_011859326.1|1.000e-929.28PREDICTED: uncharacterized protein LOC105556826 is... [more]
back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31025:SF9SI:DKEY-286J15.1coord: 12..229
NoneNo IPR availablePANTHERPTHR31025FAMILY NOT NAMEDcoord: 12..229

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_3953contigscaffold_3953:81..960 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g21287.t1g21287.t1Venturia canescensmRNAscaffold_3953 1..960 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g21287.t1-PA ID=g21287.t1-PA|Name=g21287.t1|organism=Venturia canescens|type=polypeptide|length=246bp
QDDVDGIDALKELEKNVNHLDTPHVRLLLEASLTMRRKWIKNEAKSITDI
TERYPQLRISSLIIFEFKTLLSMDEEEMTAKINRMLEKLAVYFCTEWAVD
DEGSKAHLLTQLWTRLTAKGVQKKAAKKSNMPLFTVQEHLSSTTDLNSVE
EASPRMVLYTKDKTISTAYLVADAQLRIKIHNPSVSGAVTCLIASYFTWD
VAYPPAYENTLQYLESEIIRPVTKLKPSVQKFMRDCEMKFQANNSS
back to top