g35.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg35.t1
Unique Nameg35.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length347
Homology
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1009357304|gb|KYM82576.1| (hypothetical protein ALC53_07067, partial [Atta colombica])

HSP 1 Score: 528.9 bits (1361), Expect = 1.600e-146
Identity = 265/360 (73.61%), Postives = 293/360 (81.39%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGL---------------GGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVAK HH+ARLNIYGLPHVR MG YAAVAGETTVIKCPVAGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAKNKQGR DSQT+HIEVKVPP+IDPF FP N+QA  RVHVTC VSEGD+P+KITWLKD  PLK  P E TTHQ  E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF I+W KDG  IS +  + + Y  +                    GLRVT+ DAHSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+VR
Sbjct:  449 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVAKAHHAARLNIYGLPHVRTMGNYAAVAGETTVIKCPVAGFPIASITWEKDGQILPTSRRQEVSANGTLVLYRVDSSTDRGAYTCTAKNKQGRSDSQTIHIEVKVPPKIDPFSFPDNIQAGARVHVTCAVSEGDSPLKITWLKDGRPLK--PREATTHQIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIIWSKDGEQISASGTAAVAYGPAAAAAVAATINDLRQHSQTPPGLRVTNIDAHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIVR 806          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1241838147|gb|PBC34386.1| (Down syndrome cell adhesion molecule protein [Apis cerana cerana])

HSP 1 Score: 523.1 bits (1346), Expect = 8.800e-145
Identity = 258/352 (73.30%), Postives = 288/352 (81.82%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGL-------GLGGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNIS V VE+GGEYRC+A NR+AKVHHSARLNIYGLPHVRPMG YAAVAGETTVIKCPVAGFPIASITWEKD + LPT+RRQEV PNGTLV+ HVD  TD GAYTCTAKNKQGR DSQTVHIEVKVPP+IDPF FPAN+Q   RVHV CVVSEGD+P+KITWLKD  PL     E TTH   EYDL L IQSA+T HNGNYTCVASNDAA+ + TA L+VHVPP IAPFSFNKDLSEGVRAQVTC++E+GDPPF I W KDG  I+    +   +  +G+          GLRVT+ DAHSSTI IE V+AAH+GNYTC++ N+V+EV WTAEL+VR
Sbjct:  465 MIGQYVTVHGDVISHVNISVVHVEDGGEYRCTAANRMAKVHHSARLNIYGLPHVRPMGNYAAVAGETTVIKCPVAGFPIASITWEKDGKVLPTSRRQEVFPNGTLVLHHVDRSTDHGAYTCTAKNKQGRSDSQTVHIEVKVPPKIDPFSFPANIQEGARVHVVCVVSEGDSPLKITWLKDGRPLNST--ETTTHHIGEYDLTLMIQSATTAHNGNYTCVASNDAAETSRTASLLVHVPPTIAPFSFNKDLSEGVRAQVTCMVEKGDPPFTIAWSKDGEAIAGPSPAAAGFGNTGITGPRHTQTPAGLRVTNIDAHSSTIVIERVSAAHSGNYTCMARNSVAEVLWTAELIVR 814          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|572313624|ref|XP_006622507.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2-like [Apis dorsata])

HSP 1 Score: 521.5 bits (1342), Expect = 2.600e-144
Identity = 257/345 (74.49%), Postives = 285/345 (82.61%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLGGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNIS V VE+GGEYRC+A NR+AKVHHSARLNIYGLPHVRPMG YAAVAGETTVIKCPVAGFPIASITWEKD + LPT+RRQEV PNGTLV+ HVD  TD GAYTCTAKNKQGR DSQTVHIEVKVPP+IDPF FPAN+Q   RVHV CVVSEGD+P+KITWLKD  PL     E TTH   EYDL L IQSA+T HNGNYTCVASNDAA+ + TA L+VHVPP IAPFSFNKDLSEGVRAQVTC++E+GDPPF I W KDG  I+ +  +            GLRVT+ DAHSSTI IE V+AAH+GNYTC++ N+V+EV WTAEL+VR
Sbjct:  406 MIGQYVTVHGDVISHVNISVVHVEDGGEYRCTAANRMAKVHHSARLNIYGLPHVRPMGNYAAVAGETTVIKCPVAGFPIASITWEKDGKVLPTSRRQEVFPNGTLVLHHVDRSTDHGAYTCTAKNKQGRSDSQTVHIEVKVPPKIDPFSFPANIQEGARVHVVCVVSEGDSPLKITWLKDGRPLNST--ETTTHHIGEYDLTLMIQSATTAHNGNYTCVASNDAAETSRTASLLVHVPPTIAPFSFNKDLSEGVRAQVTCMVEKGDPPFTIAWSKDGEAIAGHTQTP----------AGLRVTNIDAHSSTIVIERVSAAHSGNYTCMARNSVAEVLWTAELIVR 738          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1409305052|ref|XP_025160720.1| (Down syndrome cell adhesion molecule-like protein Dscam2 isoform X3 [Harpegnathos saltator])

HSP 1 Score: 521.2 bits (1341), Expect = 3.300e-144
Identity = 265/373 (71.05%), Postives = 289/373 (77.48%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLG----------------------------GLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVA+ HH+ARLNIYGLPHVR MG YAAVAGETTVIKCPVAGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAKNKQGR DSQT+HIEVKVPP+IDPF FPAN+QA  RVHVTC VSEGD+P+KITWLKD  PLK  P E TTH   E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF IVW KDG PIS                                             GLRVT+ DAHSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+VR
Sbjct:  473 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVARAHHAARLNIYGLPHVRAMGNYAAVAGETTVIKCPVAGFPIASITWEKDGQILPTSRRQEVSQNGTLVLHRVDSSTDRGAYTCTAKNKQGRSDSQTIHIEVKVPPKIDPFSFPANIQAGARVHVTCAVSEGDSPLKITWLKDGRPLK--PREATTHHIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIVWSKDGEPISAPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPRHSQTPPGLRVTNIDAHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIVR 843          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1409305044|ref|XP_025160716.1| (Down syndrome cell adhesion molecule-like protein Dscam2 isoform X1 [Harpegnathos saltator] >gi|1409305046|ref|XP_025160717.1| Down syndrome cell adhesion molecule-like protein Dscam2 isoform X1 [Harpegnathos saltator] >gi|1409305048|ref|XP_025160718.1| Down syndrome cell adhesion molecule-like protein Dscam2 isoform X1 [Harpegnathos saltator])

HSP 1 Score: 521.2 bits (1341), Expect = 3.300e-144
Identity = 265/373 (71.05%), Postives = 289/373 (77.48%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLG----------------------------GLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVA+ HH+ARLNIYGLPHVR MG YAAVAGETTVIKCPVAGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAKNKQGR DSQT+HIEVKVPP+IDPF FPAN+QA  RVHVTC VSEGD+P+KITWLKD  PLK  P E TTH   E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF IVW KDG PIS                                             GLRVT+ DAHSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+VR
Sbjct:  473 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVARAHHAARLNIYGLPHVRAMGNYAAVAGETTVIKCPVAGFPIASITWEKDGQILPTSRRQEVSQNGTLVLHRVDSSTDRGAYTCTAKNKQGRSDSQTIHIEVKVPPKIDPFSFPANIQAGARVHVTCAVSEGDSPLKITWLKDGRPLK--PREATTHHIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIVWSKDGEPISAPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPRHSQTPPGLRVTNIDAHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIVR 843          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1026574978|gb|OAD61732.1| (Down syndrome cell adhesion molecule-like protein Dscam2 [Eufriesea mexicana])

HSP 1 Score: 520.0 bits (1338), Expect = 7.400e-144
Identity = 258/352 (73.30%), Postives = 289/352 (82.10%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGL-------GLGGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNIS V VE+GGEYRC+A NR+AKVHH ARLNIYGLPHVRPMG YAAVAGE TVIKCPVAGFPI+SITWEKD + LPT+RRQEV PNGTLV+ HVD  TD GAYTCTAKNKQGR DSQTVHIEVKVPP+ID F FPAN+Q  TRVHV CVVS+GD+P+KITWLKD  PL     E TTHQ   YDLAL IQSA+T HNGNYTCVASNDAA+ + TA L+VHVPP IAPFSFNKDLSEGVRAQVTC++E+GDPPF I W KDG PI+  P S   +  +G+          GLRVT+ DAHSSTI IE V+AAH+GNYTC++ N+V+EV WTAEL+VR
Sbjct:  533 MIGQYVTVHGDVISHVNISVVHVEDGGEYRCTAANRMAKVHHLARLNIYGLPHVRPMGNYAAVAGEITVIKCPVAGFPISSITWEKDGKVLPTSRRQEVYPNGTLVLHHVDRSTDHGAYTCTAKNKQGRSDSQTVHIEVKVPPKIDQFSFPANIQEGTRVHVVCVVSDGDSPLKITWLKDGRPLNST--ETTTHQIGNYDLALMIQSATTAHNGNYTCVASNDAAETSRTASLLVHVPPTIAPFSFNKDLSEGVRAQVTCMVEKGDPPFTIAWSKDGEPIA-GPSSPAGFGNTGITGPRHTQTPAGLRVTNIDAHSSTIVIERVSAAHSGNYTCLARNSVAEVLWTAELIVR 881          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|332025839|gb|EGI65995.1| (Down syndrome cell adhesion molecule-like protein [Acromyrmex echinatior])

HSP 1 Score: 500.4 bits (1287), Expect = 6.100e-138
Identity = 264/413 (63.92%), Postives = 289/413 (69.98%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKV--------------------------------------------------------------------PPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLGGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVAK HH+ARLNIYGLPHVR MG YAAVAGETTVIKCPVAGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAKNKQGR DSQT+HIEVKV                                                                    PP+IDPF FP N+QA  RVHVTC VSEGD+P+KITWLKD  PLK  P E TTHQ  E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF I+W KDG  IS +               GLRVT+ DAHSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+VR
Sbjct:  283 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVAKAHHAARLNIYGLPHVRTMGNYAAVAGETTVIKCPVAGFPIASITWEKDGQILPTSRRQEVSANGTLVLHRVDSSTDRGAYTCTAKNKQGRSDSQTIHIEVKVSRKSMCMRLRRRSMMTVIRSTEILRDVVAVIAMKCFQDEVPGRRLDLSEEIARRRITSFVDLPRVVRLPPKIDPFSFPDNIQAGARVHVTCAVSEGDSPLKITWLKDGRPLK--PREATTHQIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIIWSKDGEQISASQTPP-----------GLRVTNIDAHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIVR 682          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|1009384347|gb|KYN06844.1| (hypothetical protein ALC62_02227 [Cyphomyrmex costatus])

HSP 1 Score: 499.2 bits (1284), Expect = 1.400e-137
Identity = 264/423 (62.41%), Postives = 292/423 (69.03%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKV-----------------------------------------------------------------PPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLG--------------GLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVV 345
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVAK HH+ARLNIYGLPHVR MG YAAVAGETTVIKCPVAGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAKNKQGR DSQT+HIEVKV                                                                 PP+IDPF FP N+QA  RVHVTC VSEGD+P+KITWLKD  PLK  P E TTHQ  E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF I+W KDG  IS +  + + Y  +                   GLRVT+ DAHSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+V
Sbjct:  461 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVAKAHHAARLNIYGLPHVRAMGNYAAVAGETTVIKCPVAGFPIASITWEKDGQILPTSRRQEVSANGTLVLHRVDSSTDRGAYTCTAKNKQGRSDSQTIHIEVKVSRKVYTRLRRRSMVIRSAEIFRDVVTVIAMKCFQDKVPERRLDLSEEIARRRITSFADLPKSEYIPPKIDPFSFPDNIQAGARVHVTCAVSEGDSPLKITWLKDGRPLK--PREATTHQIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIIWSKDGEQISASGTAAVAYGPAAAAAAATINDLRQHSQTPPGLRVTNIDAHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIV 881          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|607355393|gb|EZA49974.1| (Down syndrome cell adhesion molecule-like protein, partial [Ooceraea biroi])

HSP 1 Score: 487.6 bits (1254), Expect = 4.100e-134
Identity = 261/433 (60.28%), Postives = 292/433 (67.44%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVK-----------------------------------------------------------------------VPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPIS----NNPISTMNYDYS---GLGLG----------GLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNISAVRVE+GGEYRCSAVNRVAK HH+ARLNIYG+PHVR MG YAAVAGETTVIKCP AGFPIASITWEKD Q LPT+RRQEVS NGTLV+  VDS TD GAYTCTAK+KQGR DSQT+HIEVK                                                                       +PP+IDPF FP N+QA  RVHVTC VSEGD+P+KITWLK+  PLK  P E TTH   E+DLAL+IQSAST HNGNYTCVASNDAAK + TA L+VHVPP IAPFSF KDLSEG+RAQVTC++E+GDPPF I+W KDG PIS       ++   Y  S   G  +           GLRVT+ D HSS I IE VTAAHTGNYTC++ N+V+EV WTAEL+VR
Sbjct:  450 MIGQYVTVHGDVISHVNISAVRVEDGGEYRCSAVNRVAKAHHAARLNIYGVPHVRTMGNYAAVAGETTVIKCPAAGFPIASITWEKDGQILPTSRRQEVSTNGTLVLHRVDSSTDRGAYTCTAKSKQGRSDSQTIHIEVKGGSTSSSRFICEIDRTNERXXXXXXXXXXXXXXXXXXXXXXXXXXVIESAEETLCDSRRNPSRFISAAKDALPPKIDPFSFPDNIQAGARVHVTCAVSEGDSPLKITWLKEGRPLK--PREATTHHIGEFDLALRIQSASTAHNGNYTCVASNDAAKTSRTASLLVHVPPTIAPFSFKKDLSEGLRAQVTCMVEKGDPPFTIIWSKDGEPISAPGTAGAVAVAAYGSSASAGAAINDPRQHSRTPPGLRVTNIDGHSSAIVIERVTAAHTGNYTCLARNSVAEVLWTAELIVR 880          
BLAST of g35.t1 vs. GenBank_protein
Match: gi|925676454|gb|KOX73657.1| (Down syndrome cell adhesion molecule-like protein Dscam2 [Melipona quadrifasciata])

HSP 1 Score: 486.9 bits (1252), Expect = 7.000e-134
Identity = 258/417 (61.87%), Postives = 287/417 (68.82%), Query Frame = 0
Query:    1 MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYGLPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVSPNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVK-------------------------------------------------------------------VPPRIDPFRFPANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYDLALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDLSEGVRAQVTCVIEQGDPPFKIVWLKDGVPISN-NPISTMNYDYSGLG----LGGLRVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVR 346
            MIGQYVTVHGDVISHVNIS V VE+GGEYRC+A NR+AKVHHSARLNIYGLPHVRPMG YAAVAGETTVIKCPVAGFPIASITWEKD + LPT+RRQEV PNGTLV+ HVD  TD GAYTCTAKNKQGR DSQTVHIEVK                                                                   +PP+IDPF FP N+Q   RVHV CVVSEGD+P+KITWLKD  PL     E TTH   EYDL L IQSA+T +NGNYTCVASNDAA+ + TA L+VHVPP IAPFSFNKDLSEGVRAQVTC++E+GDPPF I W KDG PI+  N     N   +G        GLRVT+ DAHSSTI IE V+AAH+GNYTC++ N+V+EV WTAEL+VR
Sbjct:  444 MIGQYVTVHGDVISHVNISVVHVEDGGEYRCTAANRMAKVHHSARLNIYGLPHVRPMGNYAAVAGETTVIKCPVAGFPIASITWEKDGKVLPTSRRQEVFPNGTLVLHHVDRSTDHGAYTCTAKNKQGRSDSQTVHIEVKGKRKTSIQGPREADSSYSTRIISLALQRSFVQLESREHNADAAKRTIVSYKRAERIENVASVESNRGLPPKIDPFSFPVNIQEGARVHVVCVVSEGDSPLKITWLKDGRPLNST--ETTTHHIGEYDLTLMIQSATTANNGNYTCVASNDAAETSRTASLLVHVPPTIAPFSFNKDLSEGVRAQVTCMVEKGDPPFTIAWSKDGEPIAGPNTPGFGNTAITGPRHTQIPAGLRVTNIDAHSSTIVIERVSAAHSGNYTCLARNSVAEVLWTAELIVR 858          
The following BLAST results are available for this feature:
BLAST of g35.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1009357304|gb|KYM82576.1|1.600e-14673.61hypothetical protein ALC53_07067, partial [Atta co... [more]
gi|1241838147|gb|PBC34386.1|8.800e-14573.30Down syndrome cell adhesion molecule protein [Apis... [more]
gi|572313624|ref|XP_006622507.1|2.600e-14474.49PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1409305052|ref|XP_025160720.1|3.300e-14471.05Down syndrome cell adhesion molecule-like protein ... [more]
gi|1409305044|ref|XP_025160716.1|3.300e-14471.05Down syndrome cell adhesion molecule-like protein ... [more]
gi|1026574978|gb|OAD61732.1|7.400e-14473.30Down syndrome cell adhesion molecule-like protein ... [more]
gi|332025839|gb|EGI65995.1|6.100e-13863.92Down syndrome cell adhesion molecule-like protein ... [more]
gi|1009384347|gb|KYN06844.1|1.400e-13762.41hypothetical protein ALC62_02227 [Cyphomyrmex cost... [more]
gi|607355393|gb|EZA49974.1|4.100e-13460.28Down syndrome cell adhesion molecule-like protein,... [more]
gi|925676454|gb|KOX73657.1|7.000e-13461.87Down syndrome cell adhesion molecule-like protein ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 63..128
e-value: 7.5E-14
score: 62.0
coord: 155..225
e-value: 2.9E-6
score: 36.8
coord: 251..334
e-value: 5.9E-5
score: 32.5
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 245..345
e-value: 0.002
score: 27.4
coord: 151..236
e-value: 7.6E-4
score: 28.8
coord: 57..140
e-value: 8.2E-6
score: 35.3
NoneNo IPR availablePFAMPF13927Ig_3coord: 238..331
e-value: 5.1E-12
score: 46.2
coord: 142..222
e-value: 9.1E-12
score: 45.4
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 56..347
e-value: 1.5E-15
score: 53.5
coord: 4..59
e-value: 0.17
score: 7.0
NoneNo IPR availablePANTHERPTHR10075BASIGIN RELATEDcoord: 2..240
coord: 235..344
NoneNo IPR availablePANTHERPTHR10075:SF53coord: 2..240
coord: 235..344
NoneNo IPR availableCDDcd00096Igcoord: 4..45
e-value: 0.00282158
score: 33.7549
NoneNo IPR availableCDDcd00096Igcoord: 160..231
e-value: 4.33528E-10
score: 53.0148
NoneNo IPR availableCDDcd00096Igcoord: 256..341
e-value: 1.25489E-8
score: 49.1628
NoneNo IPR availableCDDcd00096Igcoord: 69..136
e-value: 6.50534E-13
score: 61.104
IPR013783Immunoglobulin-like foldGENE3D2.60.40.10coord: 54..141
e-value: 1.3E-19
score: 72.1
IPR013783Immunoglobulin-like foldGENE3D2.60.40.10coord: 235..344
e-value: 4.0E-21
score: 77.2
coord: 142..234
e-value: 1.0E-20
score: 75.9
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 59..138
e-value: 1.1E-12
score: 47.8
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 52..136
score: 12.223
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 239..343
score: 12.586
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 143..234
score: 10.952
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILY48726Immunoglobulincoord: 55..145
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILY48726Immunoglobulincoord: 139..241
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILY48726Immunoglobulincoord: 12..54
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILY48726Immunoglobulincoord: 232..346

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:316305..323913 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g35.t1g35.t1Venturia canescensmRNAscaffold_1 316305..323913 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g35.t1-PA ID=g35.t1-PA|Name=g35.t1|organism=Venturia canescens|type=polypeptide|length=347bp
MIGQYVTVHGDVISHVNISAVRVEEGGEYRCSAVNRVAKVHHSARLNIYG
LPHVRPMGKYAAVAGETTVIKCPVAGFPIASITWEKDEQPLPTNRRQEVS
PNGTLVIRHVDSKTDPGAYTCTAKNKQGRLDSQTVHIEVKVPPRIDPFRF
PANVQAETRVHVTCVVSEGDAPIKITWLKDDIPLKEVPGEITTHQSDEYD
LALKIQSASTMHNGNYTCVASNDAAKVAYTAPLIVHVPPKIAPFSFNKDL
SEGVRAQVTCVIEQGDPPFKIVWLKDGVPISNNPISTMNYDYSGLGLGGL
RVTSFDAHSSTIGIENVTAAHTGNYTCVSSNAVSEVSWTAELVVRGK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR036179Ig-like_dom_sf