g3577.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg3577.t1
Unique Nameg3577.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length38
Homology
The following BLAST results are available for this feature:
BLAST of g3577.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_10980contigscaffold_10980:2..295 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g3577.t1g3577.t1Venturia canescensmRNAscaffold_10980 2..295 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g3577.t1-PA ID=g3577.t1-PA|Name=g3577.t1|organism=Venturia canescens|type=polypeptide|length=38bp
KQSTYSTRVSSKSCGSNNLKMERSVGFQHLKYNFGAGA
back to top