g38.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg38.t1
Unique Nameg38.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length412
Homology
BLAST of g38.t1 vs. GenBank_protein
Match: gi|755953780|ref|XP_011302546.1| (PREDICTED: battenin [Fopius arisanus])

HSP 1 Score: 531.2 bits (1367), Expect = 3.800e-147
Identity = 261/412 (63.35%), Postives = 330/412 (80.10%), Query Frame = 0
Query:    3 IPSQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHT--ETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            I S+ +D +S  R     RWRN++AFW LGLCNNYGYVV+L+AAHDIL +KF  H+H    +++ N T     SR CNAVSTGAILLADI+P L +KL+ PFLPFF++VRM TCV  SI  FLAVS G+ QW+TI GV+LTS+SSG GE +++S  HK+G++ IA+WSSGTGGAGI+GAFSYA L V+M++E ALL ML++PV QA AFWL+++ P E  +V KY ++SQEEI+K P KT+ EKF L+P ++KY++PL LVY FEYFIN GLYELIQFD IWL+H DQYRWLQ DYQIGVFISRSSA F+TFK++W++A+ Q +NV+LF TE+IF+YIPNIWIVF +  WEGLLGGGAYVNTFY M   +P+ DLK SLGIV+M+DSLGI L+GW ++ AH+AICKLP+ +R
Sbjct:   10 IKSEHNDVESNSR---ATRWRNLLAFWFLGLCNNYGYVVVLTAAHDILASKFGTHEHDNGSSSITNTT---RDSRGCNAVSTGAILLADIVPCLIVKLMVPFLPFFIHVRMMTCVLCSISGFLAVSLGETQWITIFGVILTSISSGLGEVSVVSYSHKFGKESIASWSSGTGGAGIIGAFSYAGLTVIMTSENALLTMLIIPVIQAIAFWLLLVHPAEQPIV-KYGIDSQEEIVKMPKKTIPEKFRLLPKLMKYLIPLSLVYFFEYFINMGLYELIQFDGIWLSHSDQYRWLQVDYQIGVFISRSSAAFITFKKVWVIAILQGLNVVLFSTEAIFFYIPNIWIVFAVTFWEGLLGGGAYVNTFYSMLQTIPAEDLKDSLGIVTMADSLGITLAGWTAMEAHSAICKLPRPIR 414          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|970879523|ref|XP_015126633.1| (PREDICTED: battenin isoform X1 [Diachasma alloeum])

HSP 1 Score: 523.5 bits (1347), Expect = 8.000e-145
Identity = 260/410 (63.41%), Postives = 325/410 (79.27%), Query Frame = 0
Query:    5 SQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKF--SDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            S E++    E  +   RWRN++AFW+LGLCNNYGYVV+L+AAHDIL ++F  +DH  T +++ NAT     SR CNAVSTGAILLADI+P L +KL+ PFLPFFV+VR+ TCV  SI  FLAVS G+ QW+TI GVVLTS+SSG GE +I+S  HK+G++      SGTGGAGI+GAFSYA L ++MS+E ALL ML++PV QA AFWL+M+ P E  +V KY ++SQEEI+K P KT+ EKF L+P ++ Y++PLGLVY FEYFIN GLYELIQFD IWL H +QYRWLQ DYQIGVFISRSSA F+TFK++W+MA+ Q +NVILF TE+IF+YIPNIWIVF++  WEGLLGGGAYVNTFY M   +P+ DLK SLGIV+M+DSLGI L+GW ++ AH AICKLP+ +R
Sbjct:   14 SNENEFNDVESNSSTTRWRNLLAFWILGLCNNYGYVVVLTAAHDILASRFGTNDHDKTNSSITNAT---TDSRGCNAVSTGAILLADIVPCLLVKLMVPFLPFFVHVRLTTCVLCSIAGFLAVSLGETQWITIFGVVLTSVSSGLGEVSIVSYSHKFGKEXXXXXXSGTGGAGIIGAFSYAGLTMIMSSETALLAMLIIPVIQAIAFWLLMVHPAEQPIV-KYGIDSQEEIVKMPKKTIPEKFQLLPKLLVYLLPLGLVYFFEYFINMGLYELIQFDGIWLNHSEQYRWLQVDYQIGVFISRSSATFITFKKVWVMAILQGLNVILFSTEAIFFYIPNIWIVFVVTFWEGLLGGGAYVNTFYSMLQTIPAEDLKDSLGIVTMADSLGITLAGWTAMEAHAAICKLPRPIR 419          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|970879525|ref|XP_015126641.1| (PREDICTED: battenin isoform X2 [Diachasma alloeum])

HSP 1 Score: 523.5 bits (1347), Expect = 8.000e-145
Identity = 260/410 (63.41%), Postives = 325/410 (79.27%), Query Frame = 0
Query:    5 SQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKF--SDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            S E++    E  +   RWRN++AFW+LGLCNNYGYVV+L+AAHDIL ++F  +DH  T +++ NAT     SR CNAVSTGAILLADI+P L +KL+ PFLPFFV+VR+ TCV  SI  FLAVS G+ QW+TI GVVLTS+SSG GE +I+S  HK+G++      SGTGGAGI+GAFSYA L ++MS+E ALL ML++PV QA AFWL+M+ P E  +V KY ++SQEEI+K P KT+ EKF L+P ++ Y++PLGLVY FEYFIN GLYELIQFD IWL H +QYRWLQ DYQIGVFISRSSA F+TFK++W+MA+ Q +NVILF TE+IF+YIPNIWIVF++  WEGLLGGGAYVNTFY M   +P+ DLK SLGIV+M+DSLGI L+GW ++ AH AICKLP+ +R
Sbjct:    9 SNENEFNDVESNSSTTRWRNLLAFWILGLCNNYGYVVVLTAAHDILASRFGTNDHDKTNSSITNAT---TDSRGCNAVSTGAILLADIVPCLLVKLMVPFLPFFVHVRLTTCVLCSIAGFLAVSLGETQWITIFGVVLTSVSSGLGEVSIVSYSHKFGKEXXXXXXSGTGGAGIIGAFSYAGLTMIMSSETALLAMLIIPVIQAIAFWLLMVHPAEQPIV-KYGIDSQEEIVKMPKKTIPEKFQLLPKLLVYLLPLGLVYFFEYFINMGLYELIQFDGIWLNHSEQYRWLQVDYQIGVFISRSSATFITFKKVWVMAILQGLNVILFSTEAIFFYIPNIWIVFVVTFWEGLLGGGAYVNTFYSMLQTIPAEDLKDSLGIVTMADSLGITLAGWTAMEAHAAICKLPRPIR 414          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|665786333|ref|XP_008551919.1| (PREDICTED: battenin isoform X1 [Microplitis demolitor])

HSP 1 Score: 518.1 bits (1333), Expect = 3.400e-143
Identity = 264/409 (64.55%), Postives = 320/409 (78.24%), Query Frame = 0
Query:    1 MDIPSQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPK 410
            MD+ + +S  K +    + ARWRN IAFWL+GLCNNYGYVVMLSAAHDIL+ KFS    T     + T+ +P  R CN +STGAILLADILP L IKL  PFLPF+VNVR+A CV   IL FLAV+FG   W+TIMGV+LTS SSG GE TI+S  +KYGR  IAAWSSGTGGAG+ GAFSYA  R++M+TE  LLVMLVVPV +A AFWL+M  P+E + V KY + SQ+EIIK P KT++EK +LVP ++ Y++PL LVYLFEY+INQGL+ELIQFD IWL H +QYRW Q DYQIGVFISRSSA F TF +IWLMALFQFIN+++F TESI +YIP+IWIVF++  WEGLLGG +YVNTFY M + +P  DLK SLGIVSM+DSLGIA++G I++  H AIC+LP+
Sbjct:    1 MDVVTAKSTVKDELGGTRAARWRNFIAFWLIGLCNNYGYVVMLSAAHDILKEKFSS-PETSATTNDMTVDNP--RGCNEISTGAILLADILPCLLIKLTVPFLPFYVNVRVAICVISQILGFLAVAFGTTPWITIMGVILTSCSSGLGEITILSHSYKYGRTSIAAWSSGTGGAGVAGAFSYAGFRLIMTTETTLLVMLVVPVTEAIAFWLIMTRPNEKS-VLKYGISSQDEIIKVPKKTIKEKLSLVPGLMPYLIPLFLVYLFEYYINQGLHELIQFDGIWLNHAEQYRWYQVDYQIGVFISRSSATFFTFNKIWLMALFQFINIVIFTTESILFYIPSIWIVFVITFWEGLLGGASYVNTFYNMGETIPDKDLKDSLGIVSMADSLGIAIAGGIALPVHKAICRLPR 405          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|746845985|ref|XP_011053297.1| (PREDICTED: battenin [Acromyrmex echinatior] >gi|746845987|ref|XP_011053299.1| PREDICTED: battenin [Acromyrmex echinatior] >gi|746845989|ref|XP_011053300.1| PREDICTED: battenin [Acromyrmex echinatior] >gi|746845991|ref|XP_011053301.1| PREDICTED: battenin [Acromyrmex echinatior] >gi|332025841|gb|EGI65997.1| Battenin [Acromyrmex echinatior])

HSP 1 Score: 496.5 bits (1277), Expect = 1.000e-136
Identity = 252/409 (61.61%), Postives = 313/409 (76.53%), Query Frame = 0
Query:    8 SDTKS---QEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEP-HESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            S TKS   +E   K  RWRN+IAFW+LGLCNNYGYVVMLSAAHDIL++KF + K      + +T    T+R CN VSTGAILLADILP+L IK+ APFLPF V+ R+ATCV  S   FL VS   ++WV IMGVVLTSLSSG GE T++S  +++ +  I+ WSSGTGGAG++GA SYA L +V+S E  LLVML+VP  QA  FW+++  P H    + K  ++SQE+IIK P KT R+K  LVP ++KY++PLGLVYLFEYFINQGLYELI+F +IWLTH +QYRWLQ DYQIGVFISRSS   VT  +IW+M++ QF NVILF  E+++YYIPNIWI+F LVLWEGLLGGGAYVNTFY+M+ E+P  D + SLGI +M+DS+GIAL+GW+S+  H AICKLP+  R
Sbjct:    9 SHTKSFFDEEAILKKVRWRNLIAFWILGLCNNYGYVVMLSAAHDILQSKFGEQKD-----IPSTNNTNTTRTCNTVSTGAILLADILPALAIKITAPFLPFLVHARLATCVLFSAAGFLMVSLSMIEWVAIMGVVLTSLSSGLGEVTLLSYSNQFSKQVISTWSSGTGGAGVIGAVSYAGLTLVLSIENTLLVMLIVPFLQAVTFWVILKHPTHIRIPITKNGIDSQEQIIKVPEKTFRDKINLVPGLLKYMIPLGLVYLFEYFINQGLYELIEFKDIWLTHSEQYRWLQVDYQIGVFISRSSVNLVTINKIWIMSVLQFFNVILFFFETLYYYIPNIWIIFALVLWEGLLGGGAYVNTFYRMSTEIPKVDREASLGIATMADSIGIALAGWLSMPVHNAICKLPQPTR 412          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|350427399|ref|XP_003494746.1| (battenin [Bombus impatiens] >gi|815928981|ref|XP_012248953.1| battenin [Bombus impatiens] >gi|1366168606|ref|XP_024227907.1| battenin [Bombus impatiens] >gi|1366168609|ref|XP_024227908.1| battenin [Bombus impatiens] >gi|1366168618|ref|XP_024227909.1| battenin [Bombus impatiens])

HSP 1 Score: 496.1 bits (1276), Expect = 1.400e-136
Identity = 246/409 (60.15%), Postives = 312/409 (76.28%), Query Frame = 0
Query:    8 SDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHTETAVVNATIADPTS---RQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTL-VAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            +D   +E  A  +RWRN  AFW+LGLCNNYGYVVMLSAAHDILE+KF       T   N T+    +   R CN +STGAILLADILPSL +K + PFLPF+V+ R+ATCV  S   FL VS    +W+ I+GVV+TSLSSG GE T++S  H+Y +  IA WSSGTGGAGI+GA SYA+L + +S E  LLVML+VP+ Q   FWLV++ P +S++ + K  ++SQE II+ P K+ +EK  LVP ++KY++PLGLVYLFEYFINQGLYELI+FD+IWLTH +QYRWLQ DYQIGVFISRSS   +T  +IW+MAL QFINV++ L E++FYY+P+IWIVF  VLWEGLLGGGAYVNTFY+M+ E+P  D K+SLGI +M+DS+GIAL+GW+S+  H AIC+LP+  R
Sbjct:   15 NDVFDEESIAVRSRWRNFAAFWILGLCNNYGYVVMLSAAHDILESKFGTTMEPVTEFTNGTVTTTNTTGIRSCNTLSTGAILLADILPSLAVKTITPFLPFYVHARLATCVLFSAAGFLMVSLSTTEWLAILGVVVTSLSSGLGEVTLLSYSHQYPKQVIATWSSGTGGAGIIGALSYASLTMWLSNEDTLLVMLIVPIIQGITFWLVLVHPPQSSIPITKNGIDSQEHIIEIPRKSFKEKINLVPGLMKYMIPLGLVYLFEYFINQGLYELIEFDDIWLTHAEQYRWLQVDYQIGVFISRSSVNLITINKIWIMALLQFINVVILLFETLFYYLPSIWIVFAFVLWEGLLGGGAYVNTFYRMSTEIPRADRKISLGIATMADSIGIALAGWLSMPVHNAICRLPQPSR 423          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|1061135823|ref|XP_017891037.1| (battenin [Ceratina calcarata] >gi|1492494560|ref|XP_026675097.1| battenin [Ceratina calcarata])

HSP 1 Score: 494.6 bits (1272), Expect = 4.000e-136
Identity = 250/420 (59.52%), Postives = 318/420 (75.71%), Query Frame = 0
Query:    1 MDIPSQES-DTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKF------SDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIE-PHESTLVAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            + +P + S D   +E  A  +RWRN+ AFW+LGLCNNYGYVVMLSAAHDILE+KF      ++ K+    + N T      R CN +STGAILLADILPSL +K++ PFLPF+V+ R+ATCV  S   FL VS    +W+ I+GVV+TSLSSG GE T++S  H+Y +  IA WSSGTGGAGI+GA SYAAL   +S E  LL+ML+VPV QA  FWL+++  PH S  + K  ++SQE II+ P K+ +EK  LVP ++KY++PLGLVYLFEYFINQGLYELIQ+D IWL+H +QYRWLQ DYQIGVFISRSS   VT  +IW+MA+ QF+NVI+ L E++FYY+P+IWIVF LVLWEGLLGGGAYVNTFY+M+ E+P  D K+SLGI +M+DS+GIAL+GW+S+  H AIC+LP+  R
Sbjct:    7 LTVPERRSNDVFDEESIAVRSRWRNLAAFWMLGLCNNYGYVVMLSAAHDILESKFGTTNSGAEFKNETVTMTNIT----GVRSCNTLSTGAILLADILPSLAVKVITPFLPFYVHARLATCVLFSAAGFLVVSLSTTEWLAILGVVITSLSSGLGEVTLLSYSHQYPKQVIATWSSGTGGAGIIGALSYAALTTWLSNEDTLLLMLIVPVIQAITFWLILVHPPHSSIPITKNGIDSQEHIIEVPRKSFKEKINLVPGLLKYMIPLGLVYLFEYFINQGLYELIQYDGIWLSHAEQYRWLQVDYQIGVFISRSSVNLVTINKIWIMAVLQFVNVIILLFETLFYYMPSIWIVFALVLWEGLLGGGAYVNTFYRMSTEIPRADRKISLGIATMADSIGIALAGWLSMPVHNAICRLPQPHR 422          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|1241838143|gb|PBC34382.1| (Battenin [Apis cerana cerana])

HSP 1 Score: 494.6 bits (1272), Expect = 4.000e-136
Identity = 250/409 (61.12%), Postives = 314/409 (76.77%), Query Frame = 0
Query:    8 SDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKF--SDHKHTETAVVNATIADPTS-RQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTL-VAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            +D   +E  A  +RWRN+ AFW+LGLCNNYGYVVMLSAAHDILE+KF  +D K TE      T  + T  R CN +STGAILLADILPSL +K++ PFLPF V+ R+ATCV  S   FL VS    +W+ I+GVV+TSLSSG GE T++S  HKY +  IA WSSGTGGAGI+GA SYA+L   +S E  LL+MLVVP+ Q   FWLV++ P +S++ + K  ++SQE+II+ P K+ +EK  LVP ++KY++PLGLVYLFEYFINQGLYELI+FD IWLTH +QYRWLQ DYQIGVFISRSS   VT  +IW+MA+ QFINVI+ L E++FYY+P+IWIVF  VLWEGLLGGGAYVNTFY+M+ E+P  D K+SLGI +M+DS+GIA++GW+S+  H AIC LP+  R
Sbjct:   15 NDVFDEESIAVRSRWRNLAAFWILGLCNNYGYVVMLSAAHDILESKFGTTDPKGTELTNGTMTATNHTGIRSCNTLSTGAILLADILPSLAVKIITPFLPFHVHARLATCVLFSAAGFLVVSLSTTEWLAILGVVITSLSSGLGEVTLLSYSHKYPKQVIATWSSGTGGAGIIGALSYASLTTWLSNEDTLLLMLVVPIIQGITFWLVLVHPPQSSIPITKNGIDSQEQIIEIPRKSFKEKINLVPGLLKYMIPLGLVYLFEYFINQGLYELIEFDGIWLTHAEQYRWLQVDYQIGVFISRSSVNLVTINKIWIMAVLQFINVIILLFETLFYYLPSIWIVFTFVLWEGLLGGGAYVNTFYRMSTEIPRADRKISLGIATMADSIGIAMAGWLSMPIHNAICGLPQPKR 423          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|808116057|ref|XP_012175172.1| (battenin isoform X1 [Bombus terrestris] >gi|808116059|ref|XP_012175180.1| battenin isoform X1 [Bombus terrestris] >gi|808116061|ref|XP_012175188.1| battenin isoform X1 [Bombus terrestris] >gi|808116063|ref|XP_012175193.1| battenin isoform X1 [Bombus terrestris] >gi|1185568357|ref|XP_020723549.1| battenin isoform X1 [Bombus terrestris])

HSP 1 Score: 493.8 bits (1270), Expect = 6.800e-136
Identity = 247/409 (60.39%), Postives = 311/409 (76.04%), Query Frame = 0
Query:    8 SDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHTETAVVNATIADPTS---RQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTL-VAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            +D   +E  A  +RWRN  AFW+LGLCNNYGYVVMLSAAHDILE+KF           N T+    +   R CN +STGAILLADILPSL +K + PFLPF+V+ R+ATCV  S   FL VS    +W+ I+GVV+TSLSSG GE T++S  H+Y +  IA WSSGTGGAGI+GA SYA+L + +S E  LLVML+VP+ Q   FWLV++ P +S++ + K  ++SQE II+ P K+ +EK  LVP ++KY++PLGLVYLFEYFINQGLYELI+FD+IWLTH +QYRWLQ DYQIGVFISRSS   VT  +IW+MAL QFINVI+ L E++FYY+P+IWIVF  VLWEGLLGGGAYVNTFY+M+ E+P  D K+SLGI +M+DS+GIAL+GW+S+  H AIC+LP+  R
Sbjct:   15 NDVFDEESIAVRSRWRNFAAFWILGLCNNYGYVVMLSAAHDILESKFGTTMEPIMEFTNGTVTATNTTGIRSCNTLSTGAILLADILPSLAVKTITPFLPFYVHARLATCVLFSAAGFLMVSLSTTEWLAILGVVVTSLSSGLGEVTLLSYSHQYPKQVIATWSSGTGGAGIIGALSYASLTMWLSNEDTLLVMLIVPIIQGITFWLVLVHPPQSSIPITKNGIDSQEHIIEIPRKSFKEKINLVPGLMKYMIPLGLVYLFEYFINQGLYELIEFDDIWLTHAEQYRWLQVDYQIGVFISRSSVNLVTINKIWIMALLQFINVIILLFETLFYYLPSIWIVFAFVLWEGLLGGGAYVNTFYRMSTEIPRADRKISLGIATMADSIGIALAGWLSMPVHNAICRLPQPSR 423          
BLAST of g38.t1 vs. GenBank_protein
Match: gi|987900402|ref|XP_015432244.1| (PREDICTED: battenin [Dufourea novaeangliae] >gi|1016157135|gb|KZC04297.1| Battenin [Dufourea novaeangliae])

HSP 1 Score: 493.8 bits (1270), Expect = 6.800e-136
Identity = 246/408 (60.29%), Postives = 313/408 (76.72%), Query Frame = 0
Query:    6 QESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDILEAKFSDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLAPFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEATIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLVVPVAQAAAFWLVMIEPHESTL-VAKYALESQEEIIKAPNKTLREKFALVPTVIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGVFISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLWEGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVAHTAICKLPKSVR 413
            + SD   +E  A  +RWRN+ AFW+LGLCNNYGYVVMLSAAHDILE+KF     +    VN T+     R CN +STGAILLADILPSL +K++ PFLPF+V+ R+ATCV  S   FL VS    +W+ I+GVV+TSLSSG GE T++S  H+Y +  I+ WSSGTGGAGI+GA SYA L + +S E  LLVML++P+ Q   FWLV++ P +S++ + K  ++SQE+II+   K+ +EK  LVP ++KY++PLGLVYLFEYFINQGLYELI+FD IWLTH +QYRWLQ DYQIGVFISRSS   VT  +IW+MA+ QFINVI+ L E++FYYIP+IWIVF  VLWEGLLGGGAYVNTFY+M+ E+P  D K+SLGI +M+DS+GIAL+GW+S+  H AIC+LP+  R
Sbjct:   12 ERSDVFDEESIAVRSRWRNLAAFWILGLCNNYGYVVMLSAAHDILESKFGT-TESNMEFVNGTMNTTGLRACNTLSTGAILLADILPSLAVKVVTPFLPFYVHARLATCVLFSAAGFLVVSLSTTEWLAILGVVITSLSSGLGEVTLLSYSHQYPKQVISTWSSGTGGAGIIGALSYAFLTMWLSNEDTLLVMLIIPIIQGITFWLVLVHPPQSSIPITKNGIDSQEQIIEVHRKSFKEKINLVPGLLKYMIPLGLVYLFEYFINQGLYELIEFDGIWLTHAEQYRWLQVDYQIGVFISRSSVNIVTINKIWIMAVLQFINVIILLFETLFYYIPSIWIVFAFVLWEGLLGGGAYVNTFYRMSTEIPRADRKISLGIATMADSIGIALAGWMSMPVHNAICRLPQPTR 418          
The following BLAST results are available for this feature:
BLAST of g38.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|755953780|ref|XP_011302546.1|3.800e-14763.35PREDICTED: battenin [Fopius arisanus][more]
gi|970879523|ref|XP_015126633.1|8.000e-14563.41PREDICTED: battenin isoform X1 [Diachasma alloeum][more]
gi|970879525|ref|XP_015126641.1|8.000e-14563.41PREDICTED: battenin isoform X2 [Diachasma alloeum][more]
gi|665786333|ref|XP_008551919.1|3.400e-14364.55PREDICTED: battenin isoform X1 [Microplitis demoli... [more]
gi|746845985|ref|XP_011053297.1|1.000e-13661.61PREDICTED: battenin [Acromyrmex echinatior] >gi|74... [more]
gi|350427399|ref|XP_003494746.1|1.400e-13660.15battenin [Bombus impatiens] >gi|815928981|ref|XP_0... [more]
gi|1061135823|ref|XP_017891037.1|4.000e-13659.52battenin [Ceratina calcarata] >gi|1492494560|ref|X... [more]
gi|1241838143|gb|PBC34382.1|4.000e-13661.12Battenin [Apis cerana cerana][more]
gi|808116057|ref|XP_012175172.1|6.800e-13660.39battenin isoform X1 [Bombus terrestris] >gi|808116... [more]
gi|987900402|ref|XP_015432244.1|6.800e-13660.29PREDICTED: battenin [Dufourea novaeangliae] >gi|10... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003492Batten's disease protein Cln3PRINTSPR01315BATTENINcoord: 339..363
score: 64.0
coord: 167..187
score: 65.48
coord: 291..306
score: 67.19
coord: 376..405
score: 32.5
coord: 28..50
score: 84.24
coord: 85..101
score: 72.79
coord: 137..159
score: 53.8
coord: 316..328
score: 33.65
IPR003492Batten's disease protein Cln3PFAMPF02487CLN3coord: 26..224
e-value: 9.4E-61
score: 206.0
coord: 232..406
e-value: 7.1E-64
score: 216.3
IPR003492Batten's disease protein Cln3PANTHERPTHR10981BATTENINcoord: 10..409
IPR018460Batten's disease protein Cln3, subgroupPIRSFPIRSF015974CLN3_BTN1coord: 11..412
e-value: 1.5E-137
score: 455.9
NoneNo IPR availableGENE3D1.20.1250.20coord: 159..404
e-value: 4.6E-7
score: 30.9
NoneNo IPR availablePANTHERPTHR10981:SF0BATTENINcoord: 10..409
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 380..404
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 102..124
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 361..379
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 315..335
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 153..163
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 342..360
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 265..314
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 215..244
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 130..152
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 194..214
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 405..412
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 125..129
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 245..264
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 189..193
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 164..188
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 336..341
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..101
NoneNo IPR availableTMHMMTMhelixcoord: 163..185
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
NoneNo IPR availableTMHMMTMhelixcoord: 316..338
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 342..364
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
IPR036259MFS transporter superfamilySUPERFAMILY103473MFS general substrate transportercoord: 9..399

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:337539..341974 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g38.t1g38.t1Venturia canescensmRNAscaffold_1 337539..341974 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g38.t1-PA ID=g38.t1-PA|Name=g38.t1|organism=Venturia canescens|type=polypeptide|length=412bp
MDIPSQESDTKSQEREAKIARWRNIIAFWLLGLCNNYGYVVMLSAAHDIL
EAKFSDHKHTETAVVNATIADPTSRQCNAVSTGAILLADILPSLTIKLLA
PFLPFFVNVRMATCVGLSILSFLAVSFGQVQWVTIMGVVLTSLSSGFGEA
TIISLGHKYGRDGIAAWSSGTGGAGIVGAFSYAALRVVMSTEQALLVMLV
VPVAQAAAFWLVMIEPHESTLVAKYALESQEEIIKAPNKTLREKFALVPT
VIKYIVPLGLVYLFEYFINQGLYELIQFDNIWLTHEDQYRWLQADYQIGV
FISRSSAGFVTFKRIWLMALFQFINVILFLTESIFYYIPNIWIVFILVLW
EGLLGGGAYVNTFYKMTDEVPSNDLKVSLGIVSMSDSLGIALSGWISIVA
HTAICKLPKSVR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR003492Battenin_disease_Cln3
IPR018460Battenin_disease_Cln3_subgr
IPR036259MFS_trans_sf