g39.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg39.t1
Unique Nameg39.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length342
Homology
BLAST of g39.t1 vs. GenBank_protein
Match: gi|759072564|ref|XP_011345907.1| (putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform X1 [Ooceraea biroi] >gi|607355397|gb|EZA49978.1| Putative ribosomal RNA methyltransferase [Ooceraea biroi] >gi|1494641792|gb|RLU15652.1| hypothetical protein DMN91_011406 [Ooceraea biroi])

HSP 1 Score: 498.8 bits (1283), Expect = 1.700e-137
Identity = 243/323 (75.23%), Postives = 275/323 (85.14%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEALAT 320
            MGKTSKDKRDIYYR+AKEEGWRARSAFKLLQID E  IF GV+KAVDLCAAPGSWSQVL+RKL EN K     G ++ P+I+AVDLQAMAPL+GV+Q+QGDIT+ +TAE+IIAHF NTQADLVVCDGAPDVTGLHDMDI+IQSQLLLAALNITTHILRPGGTFVAKIFR KD+SLLY+Q+++FF +V   KPSSSRNSSIEAF+VC+DY PPEGYKPHMLNPLLTHEP NFDELTG+NR +VPFVVCGDLSQPDSD+CYPL  +GK+YEYHEP Q P+ PPYA A  LL N   D RK + SVV  +     + +FK  ALAT
Sbjct:    1 MGKTSKDKRDIYYRKAKEEGWRARSAFKLLQIDTECRIFDGVSKAVDLCAAPGSWSQVLARKLNENYKKALEKGDASPPKIVAVDLQAMAPLEGVIQLQGDITNTNTAEQIIAHFDNTQADLVVCDGAPDVTGLHDMDIFIQSQLLLAALNITTHILRPGGTFVAKIFRAKDVSLLYAQLRIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYKPHMLNPLLTHEPCNFDELTGINRVVVPFVVCGDLSQPDSDTCYPLDYEGKEYEYHEPVQTPISPPYATALSLLANKDTDFRKADVSVVIENEGPSSISEFKKRALAT 323          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|383853658|ref|XP_003702339.1| (PREDICTED: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform X3 [Megachile rotundata] >gi|805777319|ref|XP_012138216.1| PREDICTED: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase isoform X3 [Megachile rotundata])

HSP 1 Score: 493.4 bits (1269), Expect = 7.300e-136
Identity = 246/352 (69.89%), Postives = 285/352 (80.97%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFK----------LEALATKLNCESEDNIENLLDLEKL 339
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E HI  GV+KAVDLCAAPGSWSQVLSR+L EN K     G +  P+I+AVDLQAMAPL+GV+QIQGDIT+  TAE+IIAHF N  ADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD+SLLYSQ+K+FF +V   KPSSSRNSSIEAF+VC+DY PPEGYKPHMLNPLLTH+P +F+ELTG+NR IVPFVVCGDLSQPDSD+CYPL  +GK+Y+YH P Q P+ PPY EA  L+ N   D RKP+ SV   +L +  + DFK           E+  T+++C+ +DN E++L + +L
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHILDGVSKAVDLCAAPGSWSQVLSRRLNENYKKALEKGDATAPKIVAVDLQAMAPLEGVIQIQGDITNTKTAEQIIAHFDNEHADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRQGGTFVAKIFRAKDVSLLYSQLKIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYKPHMLNPLLTHKPCDFNELTGINRVIVPFVVCGDLSQPDSDTCYPLDYEGKEYKYHGPVQTPISPPYEEALLLMGNRDTDFRKPDVSVAIDNLNSMTILDFKNQAKQKRKEINESRITQVDCKEDDNSEDVLGINEL 352          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|817054097|ref|XP_012265683.1| (putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Athalia rosae])

HSP 1 Score: 490.0 bits (1260), Expect = 8.100e-135
Identity = 237/313 (75.72%), Postives = 267/313 (85.30%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNKDGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFK 314
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID EFHIF+GVTKAVDLCAAPGSWSQVLSRKL +++       P+I+AVDLQAMAPL+GVVQIQGDIT VSTAE II +F N  ADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTH+L+PGG FVAKIFR KDISLLYSQ+K+FF HV   KP SSRNSSIEAF+VC+DY PPEGY+PHMLNPLLTHE  +FD+LTGVNRY+VPFVVCGDLSQPDSD+CYPL  +GK+YEY EPNQ P+ PPY EA  L++ G + L+KP +S+    +    L +FK
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDSEFHIFEGVTKAVDLCAAPGSWSQVLSRKLNKSD----DQTPRIVAVDLQAMAPLEGVVQIQGDITKVSTAEEIIKYFQNEHADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHVLKPGGIFVAKIFRAKDISLLYSQLKVFFKHVFCTKPRSSRNSSIEAFVVCKDYSPPEGYEPHMLNPLLTHEHCDFDQLTGVNRYVVPFVVCGDLSQPDSDACYPLDYEGKEYEYREPNQSPITPPYEEAIALMEKGQLQLKKPGTSLTISSIPESSLAEFK 309          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|954554156|ref|XP_014600597.1| (PREDICTED: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Polistes canadensis])

HSP 1 Score: 489.6 bits (1259), Expect = 1.100e-134
Identity = 242/330 (73.33%), Postives = 275/330 (83.33%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEALATKLNCESE 327
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E +IF GV KAVDLCAAPGSWSQVLSRKL EN K     G +  P+I+AVDLQAMAPL+GV+QIQGDIT+ +TA+ IIA+F N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFR KD+SLLY+Q+K+FF +V  AKPSSSRNSSIEAF+VC+DY PPEGY+PHMLNPLLTHEP NF++LTGVNR IVPFVVCGDL+QPDSD+CYPL  +GK+Y+YHEP Q P+ PPY EA  L++N   D RK + SV+     +  L +FK E    K  C +E
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECNIFDGVNKAVDLCAAPGSWSQVLSRKLNENYKKALEKGEATPPKIVAVDLQAMAPLEGVIQIQGDITNTATAQHIIAYFDNMQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRAKDVSLLYAQLKIFFPYVYCAKPSSSRNSSIEAFVVCKDYSPPEGYEPHMLNPLLTHEPCNFEKLTGVNRLIVPFVVCGDLNQPDSDTCYPLNFEGKEYKYHEPVQSPIAPPYEEALSLIENRNTDFRKADVSVIIDSNRSMSLSEFK-EQARQKQKCINE 329          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|350427390|ref|XP_003494742.1| (putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Bombus impatiens])

HSP 1 Score: 487.6 bits (1254), Expect = 4.000e-134
Identity = 244/353 (69.12%), Postives = 289/353 (81.87%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEA----------LATKL-NCESEDNIENLLDLEKL 339
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E HI  GV KAVDLCAAPGSWSQVLSR+L EN K     G +  P+I+AVDLQAMAP++GV+QIQGDIT+++TA++II+HF N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD++LLY+Q+K+FF +V   KPSSSRNSSIEAF+VC+DY PPEGY+PHMLNPLLTHEP +F+ELTGVNR IVPFVVCGDLSQPDSD+CYPL  +GK+Y YHEP Q P+ PPY EA  LL++   D R+ + +VV  +L +  + DFK +A            TKL + +++DN E++L L++L
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHILDGVNKAVDLCAAPGSWSQVLSRRLNENYKKALETGNATPPKIVAVDLQAMAPIEGVIQIQGDITNINTAKQIISHFDNEQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRKGGTFVAKIFRAKDVTLLYAQLKIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYEPHMLNPLLTHEPCDFNELTGVNRVIVPFVVCGDLSQPDSDTCYPLDFEGKEYTYHEPVQTPIAPPYEEALSLLEDRDTDFRRFDVNVVVDNLNSMTIADFKKQAKQKNKETNENKVTKLQDSKNDDNNEDILGLDQL 353          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|340710517|ref|XP_003393834.1| (putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Bombus terrestris])

HSP 1 Score: 485.7 bits (1249), Expect = 1.500e-133
Identity = 241/353 (68.27%), Postives = 288/353 (81.59%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNKD----GGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEA-----------LATKLNCESEDNIENLLDLEKL 339
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E HI  GV KAVDLCAAPGSWSQVLSR+L EN K     G +  P+I+AVDLQAMAP++GV+QIQGDIT+++TA++II+HF N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD++LLY+Q+K+FF +V   KPSSSRNSSIEAF+VC+DY PPEGY+PHMLNPLLTHEP +F+ELTGVNR IVPFVVCGDLSQPDSD+CYPL  +GK+Y YHEP Q P+ PPY EA  LL++   D R+ + +VV  +L +  + DFK +A           +  + + +++DN E++L L++L
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHILDGVNKAVDLCAAPGSWSQVLSRRLNENYKKALEAGNATPPKIVAVDLQAMAPMEGVIQIQGDITNINTAKQIISHFDNEQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRQGGTFVAKIFRAKDVTLLYAQLKIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYEPHMLNPLLTHEPCDFNELTGVNRVIVPFVVCGDLSQPDSDTCYPLDFEGKEYTYHEPVQTPIAPPYQEALTLLEDRDTDFRRFDVNVVVDNLNSMTIADFKKQAKQKHKEINENKVTKQQDNKNDDNNEDILGLDQL 353          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|572313576|ref|XP_006622483.1| (PREDICTED: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase-like isoform X1 [Apis dorsata])

HSP 1 Score: 485.3 bits (1248), Expect = 2.000e-133
Identity = 240/353 (67.99%), Postives = 289/353 (81.87%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEA----------LATKL-NCESEDNIENLLDLEKL 339
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E H+  GV KAVDLCAAPGSWSQVLSR+L EN K     G +  P+I+AVDLQAMAPL+GV+QIQGDIT++ TA++II+HF N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD++LLY+Q+K+FF +V   KPSSSRNSSIEAF+VC+DY PPEGYKPHM+NPLLTH+P +F++LTG+NR IVPFVVCGDLSQPDSD+CYPL  +GK+Y YHEP Q P+ PPY EA  L+++   D R+ + +VV  +L++  ++DFK +A            T+L N + +D+ E++L L+KL
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHVLDGVNKAVDLCAAPGSWSQVLSRRLNENYKKALETGNAIPPKIVAVDLQAMAPLEGVIQIQGDITNIDTAKQIISHFDNEQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRQGGTFVAKIFRAKDVTLLYAQLKIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYKPHMMNPLLTHKPCDFNDLTGINRVIVPFVVCGDLSQPDSDTCYPLDFEGKEYTYHEPVQTPISPPYKEALSLMEDRDTDFRRYDVNVVVDNLSSMTIEDFKKQAKQKHKEINETKRTELQNNKKDDSEEDILGLDKL 353          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|752872917|ref|XP_011253721.1| (putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Camponotus floridanus] >gi|307183163|gb|EFN70073.1| Putative ribosomal RNA methyltransferase 1 [Camponotus floridanus])

HSP 1 Score: 484.6 bits (1246), Expect = 3.400e-133
Identity = 241/341 (70.67%), Postives = 278/341 (81.52%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEALATKLNCESEDNIENLLDLEK 338
            MGKTSKDKRDIYYR+AKEEGWRARSAFKLLQID E HIF GV+KAVDLCAAPGSWSQVL+RKL EN K     G ++ P+I+AVDLQAMAPL+GV+Q+QGDIT+ +TA++IIAHF NTQADLVVCDGAPDVTGLHDMDI+IQSQLLLAALNITTHILRPGGTFVAKIFR KD+S LY+Q+++FF +V   KPSSSRNSSIEAF+VC+DY PPEGYKPHMLNPLLTHEP NF+ELTGVNR IVPFVVCGDL+QPDSD CYPL +DGK Y+YHEP Q P+ PPYAEA  LL+N     R+  SS         F  D + E   T +N   E+   ++ + +K
Sbjct:    1 MGKTSKDKRDIYYRKAKEEGWRARSAFKLLQIDTECHIFDGVSKAVDLCAAPGSWSQVLARKLNENYKKALETGNASPPKIVAVDLQAMAPLEGVIQLQGDITNTNTAQQIIAHFDNTQADLVVCDGAPDVTGLHDMDIFIQSQLLLAALNITTHILRPGGTFVAKIFRAKDVSFLYAQLRIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYKPHMLNPLLTHEPCNFEELTGVNRIIVPFVVCGDLNQPDSDMCYPLNLDGKKYKYHEPVQTPIAPPYAEALSLLEN-----RRAGSS---------FTFDHETEFNETDINIAIENGASSMAEFKK 327          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|1059206489|ref|XP_017765718.1| (PREDICTED: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Eufriesea mexicana])

HSP 1 Score: 484.6 bits (1246), Expect = 3.400e-133
Identity = 236/320 (73.75%), Postives = 271/320 (84.69%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNK----DGGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEA 317
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E HI  GV K VDLCAAPGSWSQVLSR+L EN K    +G +  P+IIAVDLQAMAPL+GV+QIQGDIT+++TA++I++HF N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD++LLY+Q+K+FF +V   KPSSSRNSSIEAF+VC+DY PPEGYKPHMLNPLLTH+P +FDELTGVNR IVPFVVCGDLSQPDSD+CYPL  +GK+Y YHEP Q P+ PPY EA DLL++   D R+ + +VV  +L    + D K +A
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHILDGVNKVVDLCAAPGSWSQVLSRRLTENYKKALENGDATPPKIIAVDLQAMAPLEGVIQIQGDITNINTAKQIVSHFDNEQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRQGGTFVAKIFRAKDVTLLYAQLKIFFPYVYCTKPSSSRNSSIEAFVVCKDYSPPEGYKPHMLNPLLTHKPCDFDELTGVNRLIVPFVVCGDLSQPDSDTCYPLDFEGKEYTYHEPVQTPIAPPYQEALDLLEDRDTDFRRSDVNVVVDNLNFMTISDIKKQA 320          
BLAST of g39.t1 vs. GenBank_protein
Match: gi|380026219|ref|XP_003696852.1| (PREDICTED: LOW QUALITY PROTEIN: putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase [Apis florea])

HSP 1 Score: 483.8 bits (1244), Expect = 5.800e-133
Identity = 240/352 (68.18%), Postives = 286/352 (81.25%), Query Frame = 0
Query:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCAAPGSWSQVLSRKLKENNKD----GGSADPQIIAVDLQAMAPLDGVVQIQGDITSVSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFIVCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPDSDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVVRHDLANKFLKDFKLEA----------LATKLNCESEDNIENLLDLEKL 339
            MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQID E HI  GV KAVDLCAAPGSWSQVLSR+L EN K     G +  P+I+AVDLQAMAPL+GV+QIQGDIT++ TA++II+HF N QADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILR GGTFVAKIFR KD++LLY+Q+K+FF +V    PSSSRNSSIEAF+VC+DY PPEGYKPHM+NPLLTH+P +F+ELTGVNR IVPFVVCGDLSQPDSD+CYPL  +GK+Y YHEP Q P+ PPY EA  L+++   D R+ + +VV  +L++  ++DFK +A             +L  + +D+ E++L L+KL
Sbjct:    1 MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDNECHILDGVNKAVDLCAAPGSWSQVLSRRLNENYKKALEAGNAIPPKIVAVDLQAMAPLEGVIQIQGDITNIDTAKQIISHFDNEQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITTHILRQGGTFVAKIFRAKDVTLLYAQLKIFFPYVYCTXPSSSRNSSIEAFVVCKDYSPPEGYKPHMMNPLLTHKPCDFNELTGVNRVIVPFVVCGDLSQPDSDTCYPLDFEGKEYIYHEPVQTPISPPYKEALSLMEDRDTDFRRFDVNVVVDNLSSMTIEDFKKQAKQKHKDINETKRIELQDKKDDSEEDILGLDKL 352          
The following BLAST results are available for this feature:
BLAST of g39.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|759072564|ref|XP_011345907.1|1.700e-13775.23putative tRNA (cytidine(32)/guanosine(34)-2'-O)-me... [more]
gi|383853658|ref|XP_003702339.1|7.300e-13669.89PREDICTED: putative tRNA (cytidine(32)/guanosine(3... [more]
gi|817054097|ref|XP_012265683.1|8.100e-13575.72putative tRNA (cytidine(32)/guanosine(34)-2'-O)-me... [more]
gi|954554156|ref|XP_014600597.1|1.100e-13473.33PREDICTED: putative tRNA (cytidine(32)/guanosine(3... [more]
gi|350427390|ref|XP_003494742.1|4.000e-13469.12putative tRNA (cytidine(32)/guanosine(34)-2'-O)-me... [more]
gi|340710517|ref|XP_003393834.1|1.500e-13368.27putative tRNA (cytidine(32)/guanosine(34)-2'-O)-me... [more]
gi|572313576|ref|XP_006622483.1|2.000e-13367.99PREDICTED: putative tRNA (cytidine(32)/guanosine(3... [more]
gi|752872917|ref|XP_011253721.1|3.400e-13370.67putative tRNA (cytidine(32)/guanosine(34)-2'-O)-me... [more]
gi|1059206489|ref|XP_017765718.1|3.400e-13373.75PREDICTED: putative tRNA (cytidine(32)/guanosine(3... [more]
gi|380026219|ref|XP_003696852.1|5.800e-13368.18PREDICTED: LOW QUALITY PROTEIN: putative tRNA (cyt... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0002181 cytoplasmic translation
biological_process GO:0032259 methylation
biological_process GO:0001510 RNA methylation
biological_process GO:0002128 tRNA nucleoside ribose methylation
biological_process GO:0008033 tRNA processing
cellular_component GO:0005737 cytoplasm
molecular_function GO:0008168 methyltransferase activity
molecular_function GO:0008175 tRNA methyltransferase activity
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D3.40.50.150coord: 20..211
e-value: 5.7E-70
score: 237.0
NoneNo IPR availablePANTHERPTHR10920RIBOSOMAL RNA METHYLTRANSFERASEcoord: 1..298
IPR002877Ribosomal RNA methyltransferase FtsJ domainPFAMPF01728FtsJcoord: 21..205
e-value: 1.3E-67
score: 227.3
IPR028590tRNA (cytidine(32)/guanosine(34)-2-O)-methyltransferase, Trm7PANTHERPTHR10920:SF12TRNA (CYTIDINE(32)/GUANOSINE(34)-2'-O)-METHYLTRANSFERASE-RELATEDcoord: 1..298
IPR028590tRNA (cytidine(32)/guanosine(34)-2-O)-methyltransferase, Trm7HAMAPMF_03162RNA_methyltr_E_TRM7coord: 1..255
score: 33.415
IPR015507Ribosomal RNA large subunit methyltransferase EHAMAPMF_01547RNA_methyltr_Ecoord: 5..206
score: 32.608
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILY53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 20..206

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:343282..344842 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g39.t1g39.t1Venturia canescensmRNAscaffold_1 343282..344842 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g39.t1-PA ID=g39.t1-PA|Name=g39.t1|organism=Venturia canescens|type=polypeptide|length=342bp
MGKTSKDKRDIYYRRAKEEGWRARSAFKLLQIDREFHIFKGVTKAVDLCA
APGSWSQVLSRKLKENNKDGGSADPQIIAVDLQAMAPLDGVVQIQGDITS
VSTAERIIAHFGNTQADLVVCDGAPDVTGLHDMDIYIQSQLLLAALNITT
HILRPGGTFVAKIFRTKDISLLYSQIKLFFSHVTAAKPSSSRNSSIEAFI
VCQDYKPPEGYKPHMLNPLLTHEPLNFDELTGVNRYIVPFVVCGDLSQPD
SDSCYPLKIDGKDYEYHEPNQCPLEPPYAEASDLLKNGTIDLRKPNSSVV
RHDLANKFLKDFKLEALATKLNCESEDNIENLLDLEKLNVSN
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Biological Process
TermDefinition
GO:0002128tRNA nucleoside ribose methylation
GO:0002181cytoplasmic translation
GO:0032259methylation
GO:0008033tRNA processing
GO:0001510RNA methylation
Vocabulary: Molecular Function
TermDefinition
GO:0008175tRNA methyltransferase activity
GO:0008168methyltransferase activity
Vocabulary: INTERPRO
TermDefinition
IPR002877rRNA_MeTrfase_FtsJ_dom
IPR028590RNA_methyltr_E_Trm7
IPR015507rRNA-MeTfrase_E
IPR029063SAM-dependent_MTases