g41.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg41.t1
Unique Nameg41.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length253
Homology
BLAST of g41.t1 vs. GenBank_protein
Match: gi|972177698|ref|XP_015190905.1| (PREDICTED: uncharacterized protein LOC107074196 [Polistes dominula])

HSP 1 Score: 160.2 bits (404), Expect = 1.100e-35
Identity = 91/237 (38.40%), Postives = 151/237 (63.71%), Query Frame = 0
Query:   11 LDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCA-AAPKAVKDQVLRDLSKKHRELLTIEAIQEMARN 247
            L+ A+  L K++A FP+GAVS+YD+KP++EKIQ +R S   L++K + ++AK+     ++     S +D  +  QD  A+++IN  AI  CL+   IQDI+ N  K ++  ++ + M KLF+LND +++ +++ E  F ++L LK E Q ++  +  FL  Q   RKEKL+ TNP IAE KE I + ++KIN++K+LITN  A +A   +K+ +L ++ +KH E++  E I ++  N
Sbjct:    7 LEQALRRLRKNVAKFPIGAVSLYDHKPVEEKIQILRGSTSRLNSKKIMVKAKI--NYTKNKSSTKSKEDSFEMLQDSTAKAIINNNAIKLCLRGCTIQDIMFNKYKTDIKKKMIMAMRKLFMLNDAILSNQQSVENAFQKQLILKIECQKSILDYHTFLKEQDTQRKEKLQKTNPTIAENKEKILKFIKKINIIKKLITNFVATSAVLLMKEPLLIEMLEKHGEIINEETIMKLTEN 241          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|954567701|ref|XP_014607888.1| (PREDICTED: uncharacterized protein LOC106788808 [Polistes canadensis])

HSP 1 Score: 157.5 bits (397), Expect = 7.100e-35
Identity = 94/242 (38.84%), Postives = 147/242 (60.74%), Query Frame = 0
Query:   11 LDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCA-AAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYEYSK 252
            L+ A+ +L K++A+FP+GAVS  DYKPIK+KIQ ++ S   L ++ + ++AK+     +       N    +  QD  A+++IN  AI  CLQ   IQD+L N  K++   ++ + M K FILND +++ ++  E  F  +L+LK E Q A+  +  FL  Q N+RK+KL+ TNP IAE KE I + ++KIN+MK+LITN  A +A   VK+    ++ +KH EL+  E I ++  N   S+
Sbjct:    7 LERALKHLRKNVAEFPIGAVSWNDYKPIKDKIQILKGSTSRLCSRKIMVKAKLDYINKKSSTKNTKNS--FQMLQDTTAKAIINNNAIKLCLQGYTIQDVLFNKYKSDTKEKMIVAMRKSFILNDAILSKQQCVEDAFQRQLNLKIECQKAIFDYHTFLKEQDNLRKKKLQKTNPTIAENKEKILKFIKKINIMKKLITNFVATSAELLVKEPFFIEMLEKHAELINEETIIKLTENARKSR 246          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|861636497|gb|KMQ91886.1| (hypothetical protein RF55_8194 [Lasius niger])

HSP 1 Score: 156.0 bits (393), Expect = 2.100e-34
Identity = 94/244 (38.52%), Postives = 150/244 (61.48%), Query Frame = 0
Query:    8 LVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAK---VAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKNEV-TIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAP-KAVKDQVLRDLSKKHRELLTIEAIQEMARN 247
            L KL+ +V +L+  +  FP+GA+++ D+KP++EKIQ  R+SL+ L+A++L L+AK       RPR        +D+    Q+ ++ ++IN  AI  CL S  I  IL N E + +   +L   M KL  LND +M  +K  E+    +L+LK E Q AL  +++FL  QG IR ++L+ T P+I E K  ++R L+K+N+MK+LI N  AA+    VK  +L ++ +KHREL+ +E I +M++N
Sbjct:    3 LDKLEQSVKSLNAVLNKFPIGAITLDDFKPVEEKIQTARKSLMHLNARLLMLQAKYKQYTDNRPRQKDVGKDEEDVGSVLQNVISDTLINAKAIKLCLHSTTILSILSNKEGDVIDQKKLYTYMSKLLALNDSIMATQKAIEKDSQLQLNLKVECQKALFDYQNFLEEQGQIRNKRLQETYPEIVENKNRMERTLRKVNIMKKLIRNFIAASSYMIVKQPILLEMMEKHRELINVETILKMSQN 246          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|951535874|ref|XP_014471418.1| (PREDICTED: uncharacterized protein LOC106742727 [Dinoponera quadriceps] >gi|951535877|ref|XP_014471419.1| PREDICTED: uncharacterized protein LOC106742727 [Dinoponera quadriceps])

HSP 1 Score: 156.0 bits (393), Expect = 2.100e-34
Identity = 97/246 (39.43%), Postives = 156/246 (63.41%), Query Frame = 0
Query:   10 KLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVA-AQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKNEV-TIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAP-KAVKDQVLRDLSKKHRELLTIEAIQEMARNYEYSKN 253
            KL+  + +L++++++FP+GAVS+ DY+PI++KIQ  RESL+ L+A++L LRAK     R   L G  + ++L +  Q  ++ ++IN  AI  CL S  I  IL N E NE    +L   M KLFI+ND +++ +++ E+ F  +L+LK E Q AL+ +++FL  Q  I+  KL+ T P IA  K  ++  L+KIN+MK+LI N  AA+     K  +L ++ +KHRELL +E I +M ++ +  K+
Sbjct:    5 KLEQCIKSLNEAVSEFPIGAVSLEDYEPIEKKIQVTRESLMRLNARLLMLRAKSKHYTRHEKLRG--TEEELGEALQRIISDTLINHGAIKLCLHSATIVSILNNKEGNEEHQKKLCAYMSKLFIVNDNIISIQQSIEEAFETQLNLKVECQKALNDYKNFLKEQKEIQNRKLQETCPDIARNKSRMENTLRKINIMKKLIRNFIAASNFMLTKQPLLLEMLEKHRELLNVETILKMTQDEQNIKH 248          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|826455686|ref|XP_012533158.1| (uncharacterized protein LOC105834879 [Monomorium pharaonis])

HSP 1 Score: 154.5 bits (389), Expect = 6.000e-34
Identity = 96/243 (39.51%), Postives = 149/243 (61.32%), Query Frame = 0
Query:    8 LVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKN-EVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAPKAV-KDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            L +L+ +V  L   + +FP+GA+S+ D+KPI+EKI++ RESL  L+A+ L LRAK   ++  D   E S DD        V+ +++N   +  CL S  IQ IL N E N E   +L   M KLF LND VM  +K  E+   E+LDLK E Q AL   ++FL  Q  ++ E+L+ T P+I E K+ ++R ++KIN+MK+LI N  A +   + K+ +L ++ ++HR+LL +E I +M+++ E
Sbjct:    3 LNELERSVKQLGVVLDEFPIGAISLDDFKPIEEKIRETRESLKHLNARSLMLRAKY--KQYIDTEREGSEDDAEDALLSVVSDTLLNAKTVKLCLHSTTIQSILNNKEGNAEDQKKLYTYMNKLFTLNDNVMAIQKEIEKASQEQLDLKFECQKALFDHKNFLKEQERLQSERLQKTYPEIVENKDKMERTIRKINIMKKLIRNFIAVSSHMLEKEPILVEMLERHRDLLNVETIMKMSQSNE 243          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|1418054210|ref|XP_025268996.1| (uncharacterized protein LOC105251110 [Camponotus floridanus] >gi|307180622|gb|EFN68573.1| hypothetical protein EAG_07672 [Camponotus floridanus])

HSP 1 Score: 153.3 bits (386), Expect = 1.300e-33
Identity = 96/246 (39.02%), Postives = 154/246 (62.60%), Query Frame = 0
Query:    8 LVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAK---VAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSEKN-EVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAP-KAVKDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            L +L+ +V +L+ ++  FP+GA+S+ D+KP++E+IQ  RESL+ L+A++L L+AK     +   R   GE S+  +    Q+  + ++IN  AI  CL S  I  IL N E + +   +L   M KLF LND +M  ++  E++   +LDLK E Q AL  +++FL  Q  IR EKL+ TNP+I   K+ ++R L+KIN+MK+LI N  AA+    +K+ +L ++ + HREL+ +E I +M++N E
Sbjct:    3 LDELEQSVKSLNAALNKFPIGAISLNDFKPVEERIQTARESLMHLNARLLMLQAKYKQYTSDERRRKEGESSS--VGDTLQNVTSDTLINTKAIKLCLHSTTILSILSNKEGDAKDQEKLYTYMRKLFTLNDNIMAIQEAIERESRLQLDLKVECQKALFDYKNFLKEQEQIRSEKLQETNPEIVANKKKMERTLRKINIMKKLIRNFIAASKHMLMKEPILLEMLENHRELINVETILKMSQNNE 246          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|1510451126|ref|XP_011345199.2| (uncharacterized protein LOC105283826 [Ooceraea biroi] >gi|1494650398|gb|RLU24250.1| hypothetical protein DMN91_004461 [Ooceraea biroi])

HSP 1 Score: 153.3 bits (386), Expect = 1.300e-33
Identity = 98/243 (40.33%), Postives = 145/243 (59.67%), Query Frame = 0
Query:    8 LVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSN-DDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSE-KNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            L +L+ +V NL   I DFP+GAVS+ D+KP+ EKIQ  RESL+ L+A++L LRAK      R   G   N +DL    QD ++ ++IN  AI  CL S  I  IL   E   E   ++   M KLF LND +M  + + E    E+LDLK E Q AL   ++FL  Q  I+ E+L+ TNP+I + K  +++ L+KINV K+LI +  AA+   +  + L ++ + +RELL +E I +M+++ E
Sbjct:    3 LGELEQSVENLGAVINDFPIGAVSLDDFKPVNEKIQATRESLMHLNARLLLLRAKYKQYTERTDDGSRRNEEDLSGVLQDVISDTLINSKAIKLCLHSTTILSILSKKEGTEEDQKKIYAYMRKLFTLNDSIMAVQNSIEAASQEQLDLKVECQKALLDHKNFLKEQERIQGERLQETNPEIVKNKNRMEKSLRKINVTKKLIRSFIAASGYMLTKEPLLEMLEANRELLNVEMIAKMSQSSE 245          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|572313318|ref|XP_006622356.1| (PREDICTED: uncharacterized protein LOC102681093 [Apis dorsata])

HSP 1 Score: 152.9 bits (385), Expect = 1.700e-33
Identity = 95/247 (38.46%), Postives = 153/247 (61.94%), Query Frame = 0
Query:    3 SKAQALVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSE-KNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            SK + L++   A+  L K+I +FP+GAVSI D+KPI+EKI+  RESL  L+AK+L L+A+   +R  +   E   +++     +  A S+IN+ AI  CL S  IQ IL   E  +++  ++   M KLF+LND ++T EK  E    ++L+LK + +NAL  ++DFL  Q  +R ++L+ TNP+ A  KE I++ ++KIN+MK+LI N  AA+   + +     + + HREL+  E I ++++N E
Sbjct:    2 SKYENLIQ---AIACLSKNIYNFPIGAVSIEDFKPIEEKIKTTRESLKHLNAKLLLLKAQDEYKRNEE--SEEDTENIVTNLHEATANSLINKAAIKLCLHSYGIQAILTGEEGDHDMQKKIYAFMCKLFVLNDNILTIEKEIENALKKQLELKIQCRNALFEYKDFLKEQEELRNKRLEETNPQHAINKERINKTIEKINMMKKLIVNFIAASSHMLNEPFYVQMLEDHRELVNFETILKISQNSE 243          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|607355818|gb|EZA50370.1| (hypothetical protein X777_11181 [Ooceraea biroi])

HSP 1 Score: 152.9 bits (385), Expect = 1.700e-33
Identity = 98/243 (40.33%), Postives = 145/243 (59.67%), Query Frame = 0
Query:    8 LVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSN-DDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSE-KNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            L +L+ +V NL   I DFP+GAVS+ D+KP+ EKIQ  RESL+ L+A++L LRAK      R   G   N +DL    QD ++ ++IN  AI  CL S  I  IL   E   E   ++   M KLF LND +M  + + E    E+LDLK E Q AL   ++FL  Q  I+ E+L+ TNP+I + K  +++ L+KINV K+LI +  AA+   +  + L ++ + +RELL +E I +M+++ E
Sbjct:    3 LGELEQSVENLGAVINDFPIGAVSLDDFKPVNEKIQATRESLMHLNARLLLLRAKYKQYTERTDDGSRRNEEDLSGVLQDIISDTLINSKAIKLCLHSTTILSILSKKEGTEEDQKKIYAYMRKLFTLNDSIMAVQNSIEAASQEQLDLKVECQKALLDHKNFLKEQERIQGERLQETNPEIVKNKNRMEKSLRKINVTKKLIRSFIAASGYMLTKEPLLEMLEANRELLNVEMIAKMSQSSE 245          
BLAST of g41.t1 vs. GenBank_protein
Match: gi|820859369|ref|XP_012346622.1| (PREDICTED: uncharacterized protein LOC100864323 [Apis florea])

HSP 1 Score: 151.8 bits (382), Expect = 3.900e-33
Identity = 91/236 (38.56%), Postives = 147/236 (62.29%), Query Frame = 0
Query:   14 AVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLVALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITSCLQSGEIQDILENSE-KNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTEELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQKINVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYE 249
            A+  L K+I +FP+GAVSI D+KPI+EKI+  RESL  L+AK+L L+A+   +R  +L  E   +++     +  A S+IN  AI  CL S  IQ IL   E  +++  ++   M KLF+LND +++ EK  +    ++L+LK + +NAL  ++DFL  Q  +R ++L+ TNP+ A  KE I++ ++KIN+MK+LI N  AA+   + +     + + HREL+  E I ++++N E
Sbjct:   10 AIACLSKNICNFPIGAVSIEDFKPIEEKIRTTRESLKHLNAKLLLLKAQNEYKRNEEL--EEDTENIVTNLHEATANSLINNAAIKLCLHSYGIQAILRGEEGDHDMQKKIYACMCKLFVLNDNILSIEKEIDNALKKQLELKIQCRNALFEYKDFLKEQEELRNKRLEETNPQHAINKETINKTIEKINMMKKLIVNFIAASSHMLNEPFYVQMLEDHRELVNFETILKISQNSE 243          
The following BLAST results are available for this feature:
BLAST of g41.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|972177698|ref|XP_015190905.1|1.100e-3538.40PREDICTED: uncharacterized protein LOC107074196 [P... [more]
gi|954567701|ref|XP_014607888.1|7.100e-3538.84PREDICTED: uncharacterized protein LOC106788808 [P... [more]
gi|861636497|gb|KMQ91886.1|2.100e-3438.52hypothetical protein RF55_8194 [Lasius niger][more]
gi|951535874|ref|XP_014471418.1|2.100e-3439.43PREDICTED: uncharacterized protein LOC106742727 [D... [more]
gi|826455686|ref|XP_012533158.1|6.000e-3439.51uncharacterized protein LOC105834879 [Monomorium p... [more]
gi|1418054210|ref|XP_025268996.1|1.300e-3339.02uncharacterized protein LOC105251110 [Camponotus f... [more]
gi|1510451126|ref|XP_011345199.2|1.300e-3340.33uncharacterized protein LOC105283826 [Ooceraea bir... [more]
gi|572313318|ref|XP_006622356.1|1.700e-3338.46PREDICTED: uncharacterized protein LOC102681093 [A... [more]
gi|607355818|gb|EZA50370.1|1.700e-3340.33hypothetical protein X777_11181 [Ooceraea biroi][more]
gi|820859369|ref|XP_012346622.1|3.900e-3338.56PREDICTED: uncharacterized protein LOC100864323 [A... [more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:347598..348603 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g41.t1g41.t1Venturia canescensmRNAscaffold_1 347598..348603 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g41.t1-PA ID=g41.t1-PA|Name=g41.t1|organism=Venturia canescens|type=polypeptide|length=253bp
MDSKAQALVKLDAAVHNLHKSIADFPVGAVSIYDYKPIKEKIQDIRESLV
ALSAKVLTLRAKVAAQRPRDLPGELSNDDLHKEFQDKVAQSVINRLAITS
CLQSGEIQDILENSEKNEVTIQLRIIMEKLFILNDEVMTWEKTREQKFTE
ELDLKSELQNALSVFRDFLTNQGNIRKEKLKVTNPKIAEQKEAIDRRLQK
INVMKRLITNMCAAAPKAVKDQVLRDLSKKHRELLTIEAIQEMARNYEYS
KNG
back to top