g42.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg42.t1
Unique Nameg42.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length638
Homology
BLAST of g42.t1 vs. GenBank_protein
Match: gi|970889811|ref|XP_015110137.1| (PREDICTED: actin-binding protein IPP [Diachasma alloeum])

HSP 1 Score: 770.0 bits (1987), Expect = 7.600e-219
Identity = 579/638 (90.75%), Postives = 615/638 (96.39%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICRAVDKGQLDGFMADG   PLKSGH++Q MGFA+Q +R++++V+STVYAVG YAPKVLRNLNAQRLKNQFSDVG++AGD IIRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHS+SP+ILSIL+DFIYTGNVDITQDNVQELFAAADMLELDEVV+GCI+YLRQQLHYSNALGIYRFAEAHNRL+L+ETAL FIEVNFPQVSQEEEFLDLPK+YLIHFL SEYIH+DTEFQVFQAAYNWI HD+P RRCYVFEIL HIRLRLCSL+RL+S+IL+CKDASLIVALRSIQKDL+SNKGCLV LRA+PR+CAKKNILVIGGSKREHTADSWARDAES YETIEKYDTFTG+WSEVAPI IGRILPGVA+LDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX ++INFYRTQITISTVECYDP++N W EC SLPTSRGEA A+IAPF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRAVDKGQLDGFMADGGTQPLKSGHNSQAMGFASQPVRQSTEVTSTVYAVGQYAPKVLRNLNAQRLKNQFSDVGLMAGDKIIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSISPSILSILVDFIYTGNVDITQDNVQELFAAADMLELDEVVAGCIEYLRQQLHYSNALGIYRFAEAHNRLELMETALRFIEVNFPQVSQEEEFLDLPKEYLIHFLRSEYIHIDTEFQVFQAAYNWITHDVPTRRCYVFEILSHIRLRLCSLSRLESIILDCKDASLIVALRSIQKDLISNKGCLVPLRAQPRICAKKNILVIGGSKREHTADSWARDAESTYETIEKYDTFTGQWSEVAPITIGRILPGVALLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREINFYRTQITISTVECYDPSTNTWSECASLPTSRGEAAAIIAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|755968943|ref|XP_011306319.1| (PREDICTED: actin-binding protein IPP [Fopius arisanus])

HSP 1 Score: 761.9 bits (1966), Expect = 2.100e-216
Identity = 575/638 (90.13%), Postives = 613/638 (96.08%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICRAVDKGQLDGFMADG   PLKSGH++Q MGFA+Q +R++++V+S+VYAVG YAPKVLRNLNAQRLKNQFSDVG++AGD IIRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHS++P ILSIL+DFIYTGNVDITQDNVQELFAAADMLELDEVV+GCI+YLRQQLHYSNALGIYRFAEAHNRL+L+ETAL FI+VNFPQVSQEEEFLDLPK+YLIHFL SEYIH+DTEFQVFQAAYNWI HD+P RRCYVFEIL HIRLRLCSL+RL+S+IL+CKDASLIVALRSIQKDL+SNKGCLV LRA+PR+CAKKNILVIGGSKREHTADSWARDAES YETIEKYDTFTG+WSEVAPI IGRILPGVA+LDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX ++INFYRTQITISTVE YDP++N W EC SLPTSRGEA A+IAPF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRAVDKGQLDGFMADGGTQPLKSGHNSQAMGFASQPVRQSTEVASSVYAVGQYAPKVLRNLNAQRLKNQFSDVGLMAGDKIIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSITPGILSILVDFIYTGNVDITQDNVQELFAAADMLELDEVVAGCIEYLRQQLHYSNALGIYRFAEAHNRLELMETALRFIQVNFPQVSQEEEFLDLPKEYLIHFLRSEYIHIDTEFQVFQAAYNWITHDVPTRRCYVFEILSHIRLRLCSLSRLESIILDCKDASLIVALRSIQKDLISNKGCLVPLRAQPRICAKKNILVIGGSKREHTADSWARDAESTYETIEKYDTFTGQWSEVAPITIGRILPGVALLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREINFYRTQITISTVESYDPSTNTWSECASLPTSRGEAAAIIAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|925670767|gb|KOX68676.1| (Actin-binding protein IPP [Melipona quadrifasciata])

HSP 1 Score: 761.5 bits (1965), Expect = 2.700e-216
Identity = 578/638 (90.60%), Postives = 607/638 (95.14%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGFATQ +++ SDVS+TVYAVG YAPKVLRNLNAQRLKNQFSDVG+VAG SIIRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVS NILS+L+DFIYTGNVDITQDNVQELFAAADMLELDEVV GCI YL+QQLHYSNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVFQAAYNWIVHDIP RRCYVFEIL HIRLRLCSLARL+ VILECKDASLIVALRSIQKDLVSNKGCLV L A+PRLCAKKNILVIGGS+REH+ADSW R AES YETIEKYD FTGEWSEVAPIGIGRILPGVA+LDGKVYVVGGELESCIIAN XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H+SRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INFYRTQITISTVECYDP+SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRTADKGQLDGFMADGAVPPMKNGHNCNNMGFATQPVKQTSDVSNTVYAVGQYAPKVLRNLNAQRLKNQFSDVGLVAGGSIIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLVDFIYTGNVDITQDNVQELFAAADMLELDEVVFGCITYLKQQLHYSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFQAAYNWIVHDIPTRRCYVFEILSHIRLRLCSLARLERVILECKDASLIVALRSIQKDLVSNKGCLVPLHAQPRLCAKKNILVIGGSRREHSADSWGRAAESTYETIEKYDIFTGEWSEVAPIGIGRILPGVALLDGKVYVVGGELESCIIANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHNSRHRQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFYRTQITISTVECYDPHSNKWHECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|1059881493|ref|XP_017796163.1| (PREDICTED: actin-binding protein IPP-like [Habropoda laboriosa] >gi|915655888|gb|KOC59607.1| Actin-binding protein IPP [Habropoda laboriosa])

HSP 1 Score: 759.2 bits (1959), Expect = 1.300e-215
Identity = 573/638 (89.81%), Postives = 605/638 (94.83%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGFATQ +++ SD S+TVYAVG YAPKVLRNLNAQRLKNQFSDVG+VAG S+IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVS NILS+L+DFIYTGNVDITQDNVQELFAAADMLELDEVV GCI YL+QQLHYSNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVFQAAYNWIVHDIP RRCYVFEIL HIRLRLCSLARL+ +ILECKDASLIVALRSIQKDLVSNKGCLV L A+PRLCAKKNILVIGGS+REH+ADSW+R AES YETIEKYD FTGEWSE APIGIGRILPGVA+LDGKVY VGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H+SRHRQD  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INFYRTQITISTVECYDP+SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRTADKGQLDGFMADGAVPPIKNGHNCNNMGFATQPVKQTSDASNTVYAVGQYAPKVLRNLNAQRLKNQFSDVGLVAGGSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLVDFIYTGNVDITQDNVQELFAAADMLELDEVVFGCITYLKQQLHYSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFQAAYNWIVHDIPTRRCYVFEILSHIRLRLCSLARLERIILECKDASLIVALRSIQKDLVSNKGCLVPLHAQPRLCAKKNILVIGGSRREHSADSWSRTAESTYETIEKYDIFTGEWSEAAPIGIGRILPGVALLDGKVYAVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHNSRHRQDMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFYRTQITISTVECYDPHSNKWHECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|380030472|ref|XP_003698872.1| (PREDICTED: actin-binding protein IPP-like [Apis florea] >gi|572303118|ref|XP_006617554.1| PREDICTED: actin-binding protein IPP-like [Apis dorsata] >gi|1035610264|ref|XP_016912762.1| actin-binding protein IPP [Apis cerana] >gi|1477741747|ref|XP_006564032.3| actin-binding protein IPP [Apis mellifera] >gi|1241835217|gb|PBC31496.1| Actin-binding protein IPP [Apis cerana cerana])

HSP 1 Score: 756.9 bits (1953), Expect = 6.700e-215
Identity = 574/638 (89.97%), Postives = 606/638 (94.98%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGFATQ +++ SDVS+TVYAVG YAPKVLRNLNAQRLKNQFSDVG+VAG S+IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVS NILS+L+DFIYTGNVDITQDNVQELFAAADMLELDEVV GCI YL+QQLHYSNALGIYRFAEAHNRLDL ETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVFQAAYNWI+HDIP RRCYVFEIL HIRLRLCSLARL+ VILECKDASLIVALRSIQKDLVSNKGCLV L A+PRLCAKKNILVIGGS+REH+ADSW R AES YETIEKYD FTGEWSEVAPIGIGRILPGVA+LDGKVYVVGGELESCIIAN XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H+SRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INF+RTQITISTVECYDP+SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRTADKGQLDGFMADGAVPPIKNGHNCNNMGFATQPVKQTSDVSNTVYAVGQYAPKVLRNLNAQRLKNQFSDVGLVAGGSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLVDFIYTGNVDITQDNVQELFAAADMLELDEVVFGCITYLKQQLHYSNALGIYRFAEAHNRLDLSETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFQAAYNWIIHDIPTRRCYVFEILSHIRLRLCSLARLERVILECKDASLIVALRSIQKDLVSNKGCLVPLHAQPRLCAKKNILVIGGSRREHSADSWGRAAESTYETIEKYDIFTGEWSEVAPIGIGRILPGVALLDGKVYVVGGELESCIIANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHNSRHRQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFFRTQITISTVECYDPHSNKWHECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|805792198|ref|XP_003704028.2| (PREDICTED: actin-binding protein IPP-like [Megachile rotundata] >gi|805792202|ref|XP_012142199.1| PREDICTED: actin-binding protein IPP-like [Megachile rotundata])

HSP 1 Score: 756.1 bits (1951), Expect = 1.100e-214
Identity = 574/638 (89.97%), Postives = 604/638 (94.67%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSFHSVY+VLSRICR  DK QLDGFMADG+ PP+K+GH+   MGFATQ +++ SDVS+ VYAVG YAPKVLRNLN QRLKNQFSDVG+VAG S+IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVS NILS+LIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCI YL+QQLHYSNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVF AAYNWIVHDIP RRCYVFEIL HIRLRLCSLARL+ VILECKDASLIVALRSIQKDL+SNKGCLV L A+PRLCAKKNILVIGGS+REH+ADSW R AES YETIEKYD FTGEWSEVAPIGIGRILPGVA+LDGKVYVVGGELESCIIAN XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H+SRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INFYRTQITISTVECYDP+SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFHSVYKVLSRICRTADKRQLDGFMADGAAPPIKNGHNCSNMGFATQPVKQTSDVSNIVYAVGQYAPKVLRNLNTQRLKNQFSDVGLVAGGSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCITYLKQQLHYSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFHAAYNWIVHDIPTRRCYVFEILSHIRLRLCSLARLERVILECKDASLIVALRSIQKDLISNKGCLVPLHAQPRLCAKKNILVIGGSRREHSADSWGRAAESTYETIEKYDIFTGEWSEVAPIGIGRILPGVALLDGKVYVVGGELESCIIANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHNSRHRQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFYRTQITISTVECYDPHSNKWHECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|1059218335|ref|XP_017756064.1| (PREDICTED: actin-binding protein IPP [Eufriesea mexicana])

HSP 1 Score: 751.5 bits (1939), Expect = 2.800e-213
Identity = 568/638 (89.03%), Postives = 603/638 (94.51%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGK+NTKSF SVY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGFATQ +++ SDVSSTVYAVG YAPKVLRNLNAQRLKNQFSDVG+VAG ++IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVS NILS+L+DFIYTGNVDITQDNVQELFAAADMLELDE+V GCI+YL+QQLHYSNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVFQAAYNWI+HDIP RRCYVFEIL HIRLRLCSLARL+ VILECKDASLIVALRSIQKDLVSNKGCLV L A+PRLCAKKNILVIGGS+RE++ DSW R AES YETIEKYD FTGEWSEVAPIGIGRILPGVA+LDGKVYVVGGELESCI+AN   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHD+RHRQD  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX  +INFYRTQITISTVECYDP SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKSNTKSFQSVYKVLSRICRTADKGQLDGFMADGAVPPIKNGHNCNNMGFATQPVKQTSDVSSTVYAVGQYAPKVLRNLNAQRLKNQFSDVGLVAGGNVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSANILSLLVDFIYTGNVDITQDNVQELFAAADMLELDEIVFGCINYLKQQLHYSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFQAAYNWIIHDIPTRRCYVFEILSHIRLRLCSLARLERVILECKDASLIVALRSIQKDLVSNKGCLVPLHAQPRLCAKKNILVIGGSRREYSPDSWGRAAESTYETIEKYDIFTGEWSEVAPIGIGRILPGVALLDGKVYVVGGELESCILANCECXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDNRHRQDAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEINFYRTQITISTVECYDPQSNKWHECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|987916533|ref|XP_015434267.1| (PREDICTED: actin-binding protein IPP [Dufourea novaeangliae])

HSP 1 Score: 746.9 bits (1927), Expect = 6.900e-212
Identity = 570/638 (89.34%), Postives = 604/638 (94.67%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSFH VY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGFATQ +++ SDVS+ VYAVG YAPKVLRNLNAQRLKNQFSDVG+VAG S+IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHS+S NILS+L+DFIYTGN+DITQDNVQELFAAADMLELDEVV GCI YL+QQLH SNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+HFLSS+YIH+DTEFQVFQAAYNWIVHDIP RRCYVFEIL HIRLRLCSLARL+ VILECKDASLIVALRSIQKDLVSNKGCLV L A PRLCAKKNILVIGGS+REH+A+SW R AES YETIEKYD FTG+WSEVAPIGIGRILPGVA+LDGKVYVVGGELESCIIAN XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX +SRHRQD  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INFYRTQITISTVECYDP+SNKW+EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFHGVYKVLSRICRTADKGQLDGFMADGAVPPIKNGHNCNNMGFATQAVKQTSDVSNIVYAVGQYAPKVLRNLNAQRLKNQFSDVGLVAGGSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSLSANILSLLVDFIYTGNIDITQDNVQELFAAADMLELDEVVFGCITYLKQQLHPSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVHFLSSDYIHIDTEFQVFQAAYNWIVHDIPTRRCYVFEILSHIRLRLCSLARLERVILECKDASLIVALRSIQKDLVSNKGCLVPLHAHPRLCAKKNILVIGGSRREHSANSWGRAAESTYETIEKYDIFTGKWSEVAPIGIGRILPGVALLDGKVYVVGGELESCIIANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNSRHRQDMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFYRTQITISTVECYDPHSNKWDECASLPTSRGEAAAIVAPF 638          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|665801746|ref|XP_008548899.1| (PREDICTED: actin-binding protein IPP isoform X2 [Microplitis demolitor])

HSP 1 Score: 742.3 bits (1915), Expect = 1.700e-210
Identity = 571/638 (89.50%), Postives = 607/638 (95.14%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKN+TKSFHSVY++LSRICRAVDKGQLDG M+DG V PLKSGH++QTMGFA+Q MR+ +DV +TV+  G YA KVLR+LN QRLKNQFSDVG+VAGD++IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIH++SPNIL++L+DFIYTGNVDITQDNVQELFAAADM ELDEVV+GCI YL+QQLHYSNALGIYRFAEAHNR+DL+ETAL FIEVNFPQVSQEEEFLDLPK+YL+HFLSSEYIHVDTEFQVFQAAYNWI HDI +RRCYVFEILGHIRLRLCSL RL+SVI++CKDASLIVALRSIQKDLVSNKGCLV LRA+PRLCAKKNILVIGGSKREHT+DSWARDAES YETIEKYDTFTG+WSEVAP GIGRILPGVA+LDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX  SRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX S +INFYRTQITISTVE YDP SNKW EC SLPTSRGEA A+IAPF
Sbjct:    1 MRLKGKNDTKSFHSVYKMLSRICRAVDKGQLDGLMSDGRVQPLKSGHNSQTMGFASQTMRQ-TDV-NTVFTAGQYASKVLRHLNDQRLKNQFSDVGLVAGDNVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHAISPNILALLVDFIYTGNVDITQDNVQELFAAADMFELDEVVAGCISYLQQQLHYSNALGIYRFAEAHNRIDLMETALRFIEVNFPQVSQEEEFLDLPKEYLVHFLSSEYIHVDTEFQVFQAAYNWITHDITSRRCYVFEILGHIRLRLCSLTRLESVIIDCKDASLIVALRSIQKDLVSNKGCLVPLRAQPRLCAKKNILVIGGSKREHTSDSWARDAESTYETIEKYDTFTGQWSEVAPCGIGRILPGVALLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRHRQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSCEINFYRTQITISTVESYDPTSNKWSECASLPTSRGEAAAIIAPF 636          
BLAST of g42.t1 vs. GenBank_protein
Match: gi|1061108890|ref|XP_017880843.1| (actin-binding protein IPP [Ceratina calcarata])

HSP 1 Score: 742.3 bits (1915), Expect = 1.700e-210
Identity = 566/638 (88.71%), Postives = 602/638 (94.36%), Query Frame = 0
Query:    1 MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQTMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAGDSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDFIYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYRFAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHVDTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECKDASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTADSWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGGELESCIIANGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDSRHRQDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQDINFYRTQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF 639
            MRLKGKNNTKSF SVY+VLSRICR  DKGQLDGFMADG+VPP+K+GH+   MGF+TQ +++ SDV +TVYAVG YAPKVL+NLNAQRLKNQFSDVG+VAG S+IRAHRSVLAA SAYFNAMFTGGLVEEQQELVEIHSVSP ILS+L+DFIYTGNVDITQDNVQELFAAADMLELDEVV GCI YL+QQLHYSNALGIYRFAEAHNRLDLLETAL FI+VNFPQVSQEEEFLDLPK++L+ FLSS+YIH+DTEFQVFQAAYNWIVH+I  R+CYVFEIL HIRLRLCSLARL+ VILECKD SLIVALRSIQKDLVSNKGCLV L A+PRLCAKKN+LVIGGS+REH+ADSW R AES YETIEKYD FTG+WSEVAPI IGRILPGVA+LDGKVYVVGGELESCIIAN XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H+SRHRQD XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX Q+INFYRTQITISTVECYDP+SNKW EC SLPTSRGEA A++APF
Sbjct:    1 MRLKGKNNTKSFQSVYKVLSRICRTADKGQLDGFMADGAVPPIKNGHNCNNMGFSTQPVKQTSDVPNTVYAVGQYAPKVLKNLNAQRLKNQFSDVGLVAGGSVIRAHRSVLAAGSAYFNAMFTGGLVEEQQELVEIHSVSPKILSLLVDFIYTGNVDITQDNVQELFAAADMLELDEVVFGCITYLKQQLHYSNALGIYRFAEAHNRLDLLETALRFIQVNFPQVSQEEEFLDLPKEHLVQFLSSDYIHIDTEFQVFQAAYNWIVHEILTRKCYVFEILSHIRLRLCSLARLERVILECKDESLIVALRSIQKDLVSNKGCLVPLHAQPRLCAKKNVLVIGGSRREHSADSWGRAAESTYETIEKYDIFTGQWSEVAPISIGRILPGVALLDGKVYVVGGELESCIIANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTHNSRHRQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEINFYRTQITISTVECYDPHSNKWHECASLPTSRGEAAAIVAPF 638          
The following BLAST results are available for this feature:
BLAST of g42.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|970889811|ref|XP_015110137.1|7.600e-21990.75PREDICTED: actin-binding protein IPP [Diachasma al... [more]
gi|755968943|ref|XP_011306319.1|2.100e-21690.13PREDICTED: actin-binding protein IPP [Fopius arisa... [more]
gi|925670767|gb|KOX68676.1|2.700e-21690.60Actin-binding protein IPP [Melipona quadrifasciata... [more]
gi|1059881493|ref|XP_017796163.1|1.300e-21589.81PREDICTED: actin-binding protein IPP-like [Habropo... [more]
gi|380030472|ref|XP_003698872.1|6.700e-21589.97PREDICTED: actin-binding protein IPP-like [Apis fl... [more]
gi|805792198|ref|XP_003704028.2|1.100e-21489.97PREDICTED: actin-binding protein IPP-like [Megachi... [more]
gi|1059218335|ref|XP_017756064.1|2.800e-21389.03PREDICTED: actin-binding protein IPP [Eufriesea me... [more]
gi|987916533|ref|XP_015434267.1|6.900e-21289.34PREDICTED: actin-binding protein IPP [Dufourea nov... [more]
gi|665801746|ref|XP_008548899.1|1.700e-21089.50PREDICTED: actin-binding protein IPP isoform X2 [M... [more]
gi|1061108890|ref|XP_017880843.1|1.700e-21088.71actin-binding protein IPP [Ceratina calcarata][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0003779 actin binding
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011705BTB/Kelch-associatedSMARTSM00875BACK_2coord: 195..297
e-value: 8.0E-29
score: 111.8
IPR011705BTB/Kelch-associatedPFAMPF07707BACKcoord: 196..295
e-value: 6.4E-26
score: 90.5
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 93..190
e-value: 3.8E-26
score: 102.9
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 83..189
e-value: 2.1E-28
score: 98.8
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 93..160
score: 20.375
IPR006652Kelch repeat type 1SMARTSM00612kelc_smartcoord: 336..393
e-value: 0.34
score: 15.8
coord: 584..637
e-value: 4.7E-5
score: 32.8
coord: 536..583
e-value: 4.7E-12
score: 56.0
coord: 488..535
e-value: 4.7E-8
score: 42.8
coord: 394..440
e-value: 1.6E-8
score: 44.3
coord: 441..487
e-value: 3.0E-7
score: 40.1
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 476..521
e-value: 1.9E-8
score: 33.7
coord: 524..570
e-value: 2.0E-12
score: 46.5
coord: 573..625
e-value: 1.2E-12
score: 47.2
coord: 429..468
e-value: 4.6E-9
score: 35.7
coord: 383..426
e-value: 4.3E-11
score: 42.2
IPR017096BTB-kelch proteinPIRSFPIRSF037037Kelch_gigaxonincoord: 48..638
e-value: 4.1E-172
score: 570.5
IPR015915Kelch-type beta propellerGENE3D2.120.10.80coord: 326..453
e-value: 4.6E-30
score: 106.5
IPR015915Kelch-type beta propellerGENE3D2.120.10.80coord: 454..636
e-value: 1.8E-53
score: 183.5
NoneNo IPR availableGENE3D1.25.40.420coord: 192..309
e-value: 5.6E-27
score: 95.8
NoneNo IPR availableGENE3D3.30.710.10coord: 60..191
e-value: 3.4E-39
score: 136.0
NoneNo IPR availablePANTHERPTHR24412FAMILY NOT NAMEDcoord: 79..631
NoneNo IPR availableCDDcd14735BACK_Kelchcoord: 190..246
e-value: 1.30285E-21
score: 86.3786
IPR030104Actin-binding protein IPPPANTHERPTHR24412:SF35ACTIN-BINDING PROTEIN IPPcoord: 79..631
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILY54695POZ domaincoord: 71..188
IPR011043Galactose oxidase/kelch, beta-propellerSUPERFAMILY50965Galactose oxidase, central domaincoord: 334..592

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:349961..352790 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g42.t1g42.t1Venturia canescensmRNAscaffold_1 349961..352790 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g42.t1-PA ID=g42.t1-PA|Name=g42.t1|organism=Venturia canescens|type=polypeptide|length=638bp
MRLKGKNNTKSFHSVYRVLSRICRAVDKGQLDGFMADGSVPPLKSGHDTQ
TMGFATQQMREASDVSSTVYAVGHYAPKVLRNLNAQRLKNQFSDVGIVAG
DSIIRAHRSVLAASSAYFNAMFTGGLVEEQQELVEIHSVSPNILSILIDF
IYTGNVDITQDNVQELFAAADMLELDEVVSGCIDYLRQQLHYSNALGIYR
FAEAHNRLDLLETALHFIEVNFPQVSQEEEFLDLPKDYLIHFLSSEYIHV
DTEFQVFQAAYNWIVHDIPARRCYVFEILGHIRLRLCSLARLDSVILECK
DASLIVALRSIQKDLVSNKGCLVSLRAEPRLCAKKNILVIGGSKREHTAD
SWARDAESIYETIEKYDTFTGEWSEVAPIGIGRILPGVAVLDGKVYVVGG
ELESCIIANGECYDPRDNVWTSIACMTEPRCEFGLCALDNALYAFGGWVG
EDIGGSIETYDPLTNKWELHGQLPEPRFSMGVVAYEGLIYVIGGCTHDSR
HRQDTMTYNPVTREWNSLAPMLTPRSQMGITILDGYLYVVGGTNKNQEFR
TTVERYSFEKNKWTAVAPMSIGRSYPAVAAADGRLYVIGGDQSQDINFYR
TQITISTVECYDPNSNKWEECTSLPTSRGEAVAVIAPF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR011705BACK
IPR000210BTB/POZ_dom
IPR006652Kelch_1
IPR017096BTB-kelch_protein
IPR015915Kelch-typ_b-propeller
IPR030104IPP
IPR011333SKP1/BTB/POZ_sf
IPR011043Gal_Oxase/kelch_b-propeller
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding