g43.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg43.t1
Unique Nameg43.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length175
Homology
BLAST of g43.t1 vs. GenBank_protein
Match: gi|817198396|ref|XP_012274842.1| (uncharacterized protein LOC105696721 [Orussus abietinus])

HSP 1 Score: 126.7 bits (317), Expect = 9.300e-26
Identity = 66/132 (50.00%), Postives = 87/132 (65.91%), Query Frame = 0
Query:   11 MESTLSHLTVLFDEIVNRYREIWSRDRDLGYPDFRGGDGGDTAATFDDLVSLRREEIARLNTVLPKLEESYLQKLRDCWSSLVAKMRQTALSDARKFEEFVTSIQIQLLTHQVSPGSD-----ERLDIEPRN 138
            +E T+ +L+ LF+EIV  YR  W RDR+LGYP +R G  GD A + ++   +R+EEIARLN +LPKLE SY++KLRD WSSL  KMRQT   D R F     S+++QL+TH  S G D     ERL  + +N
Sbjct:  319 VEETILYLSTLFEEIVRCYRRDWQRDRELGYPGYRDGQ-GDPAGSSEEERKIRQEEIARLNAILPKLENSYMKKLRDGWSSLTEKMRQTGSRDPRIFRGIAASLRVQLVTHHNSSGEDPDGNLERLSEQRKN 449          
BLAST of g43.t1 vs. GenBank_protein
Match: gi|1430504104|ref|XP_020710353.2| (uncharacterized protein LOC110117227 [Athalia rosae])

HSP 1 Score: 111.3 bits (277), Expect = 4.000e-21
Identity = 50/118 (42.37%), Postives = 84/118 (71.19%), Query Frame = 0
Query:   11 MESTLSHLTVLFDEIVNRYREIWSRDRDLGYPDFRGGDGGDTAATFDDLVSLRREEIARLNTVLPKLEESYLQKLRDCWSSLVAKMRQTALSDARKFEEFVTSIQIQLLTHQVSPGSD 129
            +E+T+S+L+ LF+ I++ Y++ W RDR+LGYP ++G    D  AT ++ + ++ EEIARLNT+LPKLE++ ++KL + W SL+ K+RQTA  + +KF+  +  + + LLT+Q+    D
Sbjct:  652 VETTISYLSTLFEGIISSYKKNWQRDRELGYPGYKGRQ-SDHMATTEEQLKIKTEEIARLNTILPKLEDTCIEKLTESWLSLMTKIRQTANKNVKKFKSVIALLHLHLLTYQIFSKED 768          
The following BLAST results are available for this feature:
BLAST of g43.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|817198396|ref|XP_012274842.1|9.300e-2650.00uncharacterized protein LOC105696721 [Orussus abie... [more]
gi|1430504104|ref|XP_020710353.2|4.000e-2142.37uncharacterized protein LOC110117227 [Athalia rosa... [more]
back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 146..175

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:354617..355144 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g43.t1g43.t1Venturia canescensmRNAscaffold_1 354617..355144 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g43.t1-PA ID=g43.t1-PA|Name=g43.t1|organism=Venturia canescens|type=polypeptide|length=175bp
MIPQVLAPEYMESTLSHLTVLFDEIVNRYREIWSRDRDLGYPDFRGGDGG
DTAATFDDLVSLRREEIARLNTVLPKLEESYLQKLRDCWSSLVAKMRQTA
LSDARKFEEFVTSIQIQLLTHQVSPGSDERLDIEPRNKNCTEIQHFPEPA
HSSSRKNDEHTSLNFEFRPGGTGDS
back to top