g44.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg44.t1
Unique Nameg44.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length318
Homology
BLAST of g44.t1 vs. GenBank_protein
Match: gi|817198396|ref|XP_012274842.1| (uncharacterized protein LOC105696721 [Orussus abietinus])

HSP 1 Score: 201.1 bits (510), Expect = 7.000e-48
Identity = 125/249 (50.20%), Postives = 160/249 (64.26%), Query Frame = 0
Query:    1 MSRGKKAKKKIGARRKQDSSVIASSMRLTGADGSSVTSINKSHTLELSSKLAKAKP--LRSKSVEIAERTSKLAESRDFKEKKDAEVVGKSIN-ASNLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNS 247
            MSRG+KAKKK   R +       +S+R+       + S+   H L   SK A  +P     +S   + ++   +   D    +      K  +  + L  FFK +ELQ LR VL+++DLS TPLLLGAIILGK+DVVK+LL+DGYPINS   EDK T LMWAV  K+LEMINLLV +GADLTL+D+N DN+ALIA+QS SW + DFLDFW SI RKID  H N RG TILHYA +RQW VL +L+ + +
Sbjct:    1 MSRGRKAKKKTKLREQP----TMASLRVK----EEIGSLPIRHGLPGGSKSAVIRPWLCGGESAGQSAKSPSNSCGCDVSVYRQPRTAKKQRHLGTGLTNFFKGDELQRLRKVLQKSDLSNTPLLLGAIILGKLDVVKKLLKDGYPINS-CTEDKKTPLMWAVSNKNLEMINLLVEHGADLTLVDKNRDNIALIAIQSPSWSETDFLDFWNSIHRKIDPGHTNIRGNTILHYAVKRQWDVLVELLRKEA 240          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|1430504104|ref|XP_020710353.2| (uncharacterized protein LOC110117227 [Athalia rosae])

HSP 1 Score: 158.3 bits (399), Expect = 5.200e-35
Identity = 79/148 (53.38%), Postives = 109/148 (73.65%), Query Frame = 0
Query:   95 LAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDRKIDLKHVNTRGYTILHYARERQWHVLAKLI 243
            +++ F + ELQ L+  L  TD+S  P LL A++L K + VKRLL+DG+ ++S   EDK+T LMWAV  K+LE+IN+L+++ AD TLLD + +N ALIA+QS+ WD+NDFLDFW +I  +ID+ H N RG TILHYA +RQW+VL   I
Sbjct:    1 MSMLFNAAELQKLKQALHVTDVSCVPQLLCAVVLEKSETVKRLLKDGHYVDS-CAEDKSTPLMWAVHNKNLEIINVLIQHDADPTLLDNDINNSALIAIQSACWDENDFLDFWKTISSRIDIDHGNIRGNTILHYAIKRQWNVLVDQI 147          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|939251748|ref|XP_014245488.1| (uncharacterized protein LOC106664340 isoform X1 [Cimex lectularius] >gi|939251750|ref|XP_014245489.1| uncharacterized protein LOC106664340 isoform X1 [Cimex lectularius] >gi|939251752|ref|XP_014245491.1| uncharacterized protein LOC106664340 isoform X1 [Cimex lectularius])

HSP 1 Score: 127.5 bits (319), Expect = 9.900e-26
Identity = 58/154 (37.66%), Postives = 102/154 (66.23%), Query Frame = 0
Query:   94 NLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSI-DRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNS 247
            +++  FKSE++  + ++L   +L  + + LGA++LG+  +VK+LLR+GY +  +  ED T+ ++WAV+ K ++M + L+R GA++ + D   +N  L+A+Q+SSWDQ+ F+DFW  I D +I++ H N  G T++HY  +RQW    +L+   S
Sbjct:   38 SVSTLFKSEDIVEITNILNIAELDDSNVFLGAVVLGRFHIVKKLLREGYSL-EKCAEDGTSPMLWAVKLKLVDMADFLIRRGANVNMTDGEGNNAFLLALQTSSWDQDTFMDFWLKIKDTEINVNHANKLGNTVIHYMVKRQWDTALELVASTS 190          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|939251754|ref|XP_014245492.1| (uncharacterized protein LOC106664340 isoform X2 [Cimex lectularius])

HSP 1 Score: 127.5 bits (319), Expect = 9.900e-26
Identity = 58/154 (37.66%), Postives = 102/154 (66.23%), Query Frame = 0
Query:   94 NLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSI-DRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNS 247
            +++  FKSE++  + ++L   +L  + + LGA++LG+  +VK+LLR+GY +  +  ED T+ ++WAV+ K ++M + L+R GA++ + D   +N  L+A+Q+SSWDQ+ F+DFW  I D +I++ H N  G T++HY  +RQW    +L+   S
Sbjct:   38 SVSTLFKSEDIVEITNILNIAELDDSNVFLGAVVLGRFHIVKKLLREGYSL-EKCAEDGTSPMLWAVKLKLVDMADFLIRRGANVNMTDGEGNNAFLLALQTSSWDQDTFMDFWLKIKDTEINVNHANKLGNTVIHYMVKRQWDTALELVASTS 190          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|939251756|ref|XP_014245493.1| (uncharacterized protein LOC106664340 isoform X3 [Cimex lectularius])

HSP 1 Score: 127.5 bits (319), Expect = 9.900e-26
Identity = 58/154 (37.66%), Postives = 102/154 (66.23%), Query Frame = 0
Query:   94 NLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSI-DRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNS 247
            +++  FKSE++  + ++L   +L  + + LGA++LG+  +VK+LLR+GY +  +  ED T+ ++WAV+ K ++M + L+R GA++ + D   +N  L+A+Q+SSWDQ+ F+DFW  I D +I++ H N  G T++HY  +RQW    +L+   S
Sbjct:   38 SVSTLFKSEDIVEITNILNIAELDDSNVFLGAVVLGRFHIVKKLLREGYSL-EKCAEDGTSPMLWAVKLKLVDMADFLIRRGANVNMTDGEGNNAFLLALQTSSWDQDTFMDFWLKIKDTEINVNHANKLGNTVIHYMVKRQWDTALELVASTS 190          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|1233162043|ref|XP_022205041.1| (uncharacterized protein LOC111061653 [Nilaparvata lugens])

HSP 1 Score: 116.3 bits (290), Expect = 2.300e-22
Identity = 73/219 (33.33%), Postives = 117/219 (53.42%), Query Frame = 0
Query:   66 ERTSKLAESRDFKEKK-----DAEVVGKSINASNLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDR-----KIDLKHVNTRGYTILHYARERQWHVLAKLIDRNSTLLTRIDSISKNPCFCC-YCSTASATPR 274
            +R  K    R+ +++K     DA  +      SN   + K +++Q +R++L    L    LLLG++ +G   VVKRLL+ G  INS+ + D  T LMWAV+ K LEMI+LL++  AD++  +   DN  L+A+QS +W Q+ FLD   +I R     +  + H N +GYT+LH++ +R+W+ +   +  +   +  ID     P     YC   S   R
Sbjct:    6 KRNKKKENRRNAEQEKRFTDGDAANLSGVKKESNYISYLKKDDVQEIRNLLSSEVLDDCDLLLGSVAIGNFSVVKRLLKHGCQINSRGKND-WTCLMWAVKCKRLEMIDLLIKRSADISATNAEGDNAMLLAIQSDAWHQDAFLDLCNTISRFTTTFREVVNHANKKGYTLLHFSVKRKWNNIVDRLIEDGADVDCIDYRGITPLMIAGYCGDISLIKR 223          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|1574108428|gb|RZF44372.1| (hypothetical protein LSTR_LSTR007947 [Laodelphax striatella])

HSP 1 Score: 114.8 bits (286), Expect = 6.600e-22
Identity = 65/158 (41.14%), Postives = 93/158 (58.86%), Query Frame = 0
Query:   92 ASNLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDR-----KIDLKHVNTRGYTILHYARERQW-HVLAKLID 244
            ASN   + K +ELQ +R +L    L    LL GA+ +G   VVKRLL+ G  IN    ++  T LMWAV+ K  EMI+LL++  AD+   +   DN  L+A+QS  W Q+ FLD   +I R     K  + H N +GYT+LH + +RQW +++ +LID
Sbjct:  416 ASNYISYLKKDELQEIRIILNTDVLDDCDLLQGAVAIGNFSVVKRLLKHGCQINC-CGKNGWTCLMWAVKFKRFEMIDLLIKRSADIAAANTEGDNAMLLAIQSDCWHQDAFLDLLNTISRFSSSFKEVVNHANKKGYTLLHLSVKRQWENIVDRLID 572          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|1573042869|gb|RZC41499.1| (uncharacterized protein BDFB_001381 [Asbolus verrucosus])

HSP 1 Score: 114.4 bits (285), Expect = 8.600e-22
Identity = 58/169 (34.32%), Postives = 105/169 (62.13%), Query Frame = 0
Query:   76 DFKEKKDAEVVGKSINASNLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDRK--IDLKHVNTRGYTILHYARERQWHVLAKLI 243
            D  + KD  V  K I A     +F +EE+  ++S+++  D++  P ++GA +L K D++K+LL+DGY IN Q+ ++  TALMWAV+ K L++++ L+ NGAD T+  ++ DNV ++A++   WD++  ++ W ++ +   ID+   +  G+ +LH    R W  L K++
Sbjct:  407 DVTKTKDV-VTNKKIYA-----YFTNEEITEIKSIMKMKDVTGVPFVIGATMLYKFDLLKKLLKDGYNIN-QTGQNNMTALMWAVKYKYLDIVDYLLNNGADPTIKTDSGDNVLILALEHKLWDEHSMINLWKAVKKVSFIDVNFTSKNGHNMLHMCVRRDWEELLKIL 568          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|478249854|gb|ENN70361.1| (hypothetical protein YQE_12869, partial [Dendroctonus ponderosae])

HSP 1 Score: 112.5 bits (280), Expect = 3.300e-21
Identity = 55/151 (36.42%), Postives = 91/151 (60.26%), Query Frame = 0
Query:   94 NLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDR--KIDLKHVNTRGYTILHYARERQWHVLAKLI 243
            N   FF + EL  ++S LR  ++   P+ +G +IL K++ ++  +  G  IN +   + TTAL+WAV+ K L+MI  L+ NGAD  +  EN +N  LIA++   WD+  F+++W  + +  +I++  +N  G+TILH A  R+W  L KL+
Sbjct:   24 NQYAFFNANELAQIKSALRIKEVLSIPIAIGCVILNKLETLEEAIGSGVNIN-EIGPNNTTALIWAVKLKYLDMIEFLLNNGADPNMKVENGENTVLIALEHKLWDEQSFMEYWGMVSKVSRIEVNAINKNGHTILHIAVRREWEKLIKLL 173          
BLAST of g44.t1 vs. GenBank_protein
Match: gi|1130268560|ref|XP_019771960.1| (PREDICTED: uncharacterized protein LOC109545616 [Dendroctonus ponderosae])

HSP 1 Score: 112.5 bits (280), Expect = 3.300e-21
Identity = 55/151 (36.42%), Postives = 91/151 (60.26%), Query Frame = 0
Query:   94 NLAIFFKSEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEEDKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQNDFLDFWYSIDR--KIDLKHVNTRGYTILHYARERQWHVLAKLI 243
            N   FF + EL  ++S LR  ++   P+ +G +IL K++ ++  +  G  IN +   + TTAL+WAV+ K L+MI  L+ NGAD  +  EN +N  LIA++   WD+  F+++W  + +  +I++  +N  G+TILH A  R+W  L KL+
Sbjct:   24 NQYAFFNANELAQIKSALRIKEVLSIPIAIGCVILNKLETLEEAIGSGVNIN-EIGPNNTTALIWAVKLKYLDMIEFLLNNGADPNMKVENGENTVLIALEHKLWDEQSFMEYWGMVSKVSRIEVNAINKNGHTILHIAVRREWEKLIKLL 173          
The following BLAST results are available for this feature:
BLAST of g44.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|817198396|ref|XP_012274842.1|7.000e-4850.20uncharacterized protein LOC105696721 [Orussus abie... [more]
gi|1430504104|ref|XP_020710353.2|5.200e-3553.38uncharacterized protein LOC110117227 [Athalia rosa... [more]
gi|939251748|ref|XP_014245488.1|9.900e-2637.66uncharacterized protein LOC106664340 isoform X1 [C... [more]
gi|939251754|ref|XP_014245492.1|9.900e-2637.66uncharacterized protein LOC106664340 isoform X2 [C... [more]
gi|939251756|ref|XP_014245493.1|9.900e-2637.66uncharacterized protein LOC106664340 isoform X3 [C... [more]
gi|1233162043|ref|XP_022205041.1|2.300e-2233.33uncharacterized protein LOC111061653 [Nilaparvata ... [more]
gi|1574108428|gb|RZF44372.1|6.600e-2241.14hypothetical protein LSTR_LSTR007947 [Laodelphax s... [more]
gi|1573042869|gb|RZC41499.1|8.600e-2234.32uncharacterized protein BDFB_001381 [Asbolus verru... [more]
gi|478249854|gb|ENN70361.1|3.300e-2136.42hypothetical protein YQE_12869, partial [Dendrocto... [more]
gi|1130268560|ref|XP_019771960.1|3.300e-2136.42PREDICTED: uncharacterized protein LOC109545616 [D... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 222..250
e-value: 1500.0
score: 3.7
coord: 116..146
e-value: 520.0
score: 7.1
coord: 151..180
e-value: 3.8E-4
score: 29.8
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 151..183
score: 11.247
IPR036770Ankyrin repeat-containing domain superfamilyGENE3D1.25.40.20coord: 87..247
e-value: 1.1E-20
score: 76.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILY48403Ankyrin repeatcoord: 115..241
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 107..180
e-value: 1.4E-7
score: 32.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 117..230
score: 17.529
IPR020683Ankyrin repeat-containing domainCDDcd00204ANKcoord: 118..242
e-value: 5.21789E-18
score: 76.6534
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 117..205

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:355242..356418 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g44.t1g44.t1Venturia canescensmRNAscaffold_1 355242..356418 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g44.t1-PA ID=g44.t1-PA|Name=g44.t1|organism=Venturia canescens|type=polypeptide|length=318bp
MSRGKKAKKKIGARRKQDSSVIASSMRLTGADGSSVTSINKSHTLELSSK
LAKAKPLRSKSVEIAERTSKLAESRDFKEKKDAEVVGKSINASNLAIFFK
SEELQTLRSVLRRTDLSKTPLLLGAIILGKVDVVKRLLRDGYPINSQSEE
DKTTALMWAVRRKDLEMINLLVRNGADLTLLDENNDNVALIAVQSSSWDQ
NDFLDFWYSIDRKIDLKHVNTRGYTILHYARERQWHVLAKLIDRNSTLLT
RIDSISKNPCFCCYCSTASATPRYKSKQVGQSSIGKNGPSSQIWHCGRSF
LPVFLVSQVLLQDFRACE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding