g4436.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg4436.t1
Unique Nameg4436.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length37
Homology
The following BLAST results are available for this feature:
BLAST of g4436.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 3..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_16612contigscaffold_16612:1..112 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g4436.t1g4436.t1Venturia canescensmRNAscaffold_16612 1..112 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g4436.t1-PA ID=g4436.t1-PA|Name=g4436.t1|organism=Venturia canescens|type=polypeptide|length=37bp
MDARQEEEEEEEEVEEEERLNEERLEARRFGLWFQEL
back to top