g45.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg45.t1
Unique Nameg45.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length355
Homology
BLAST of g45.t1 vs. GenBank_protein
Match: gi|987903135|ref|XP_015439041.1| (PREDICTED: replication factor C subunit 3 [Dufourea novaeangliae] >gi|1016158594|gb|KZC05756.1| Replication factor C subunit 3 [Dufourea novaeangliae])

HSP 1 Score: 579.7 bits (1493), Expect = 8.100e-162
Identity = 278/351 (79.20%), Postives = 323/351 (92.02%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA+ LKNMVQKGDFPHLLV+GPPGAGKKTRIM II+ELYG+G ERLRME M FETPSKKKL+I TISSN+HIE+NPSDVGIYDRVV+MDLIKTTAQT+QID SGQRDFKVV+LTN+DQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCL +R+ AP+ ++I++IL  +CKREGL LPDELA RL+ TSGRNLRRA+LMLEACKVEQYPFT  Q+ITEPDWQVYIR TA++MV+EQ+PKK+LE+RNRLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEH+MHRGSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQAEYLKNMVQKGDFPHLLVYGPPGAGKKTRIMCIIKELYGNGAERLRMETMNFETPSKKKLEITTISSNYHIEVNPSDVGIYDRVVVMDLIKTTAQTHQIDSSGQRDFKVVLLTNLDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLEIRVPAPSILDIKNILHLVCKREGLTLPDELAVRLAETSGRNLRRALLMLEACKVEQYPFTVNQKITEPDWQVYIRNTANMMVSEQSPKKLLEIRNRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHKMHRGSKAIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|350424978|ref|XP_003493974.1| (replication factor C subunit 3 [Bombus impatiens])

HSP 1 Score: 579.3 bits (1492), Expect = 1.100e-161
Identity = 279/351 (79.49%), Postives = 322/351 (91.74%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT L KLDYH EQA+ LKNM+QKGDFPHLLV+GP GAGKKTRIM IIRELYGSGV+RLRME M FETPSKKKL+I TISSN+HIE+NPSDVGI+DR+V+MDL+KTTAQT+QIDPSGQ++FKVV+LTNVDQLT++AQHALRRTMEKYVT+CRLILCAN+TSRV PAIRSRCLG+R+ AP+  +I+ IL  ICKREGL LPDELATRL+  SGRNLRRAILMLEACKVEQYPFTA+Q ITEPDWQVYIR TA++MV+EQ PKK+L +RNRLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMHRGSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTVLGKLDYHKEQAEYLKNMIQKGDFPHLLVYGPSGAGKKTRIMCIIRELYGSGVDRLRMETMTFETPSKKKLEITTISSNYHIEVNPSDVGIHDRIVVMDLVKTTAQTHQIDPSGQKEFKVVLLTNVDQLTKEAQHALRRTMEKYVTTCRLILCANSTSRVLPAIRSRCLGIRVPAPSISDIKDILHSICKREGLTLPDELATRLAECSGRNLRRAILMLEACKVEQYPFTADQSITEPDWQVYIRNTANMMVSEQNPKKLLTIRNRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHRMHRGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|572304958|ref|XP_006618427.1| (PREDICTED: replication factor C subunit 3-like isoform X1 [Apis dorsata] >gi|572304960|ref|XP_006618428.1| PREDICTED: replication factor C subunit 3-like isoform X2 [Apis dorsata])

HSP 1 Score: 577.8 bits (1488), Expect = 3.100e-161
Identity = 278/351 (79.20%), Postives = 321/351 (91.45%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA  LKNM+QKGDFPHLLV+GP GAGKKTRIM II+ELYGSG ERLRME M FETPSKKKL+I TISSN+HIE+NPSDVGIYDRVV+MDL+KTTAQT+QIDP+GQ++FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP+   I+ IL  ICKREGL LPDELATRL+ TSGRNLRRAILMLEACKVEQYPFTA+Q ITEPDWQVYIR TA++MV+EQ+PKK+L +R+RLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMH+GSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQASYLKNMIQKGDFPHLLVYGPSGAGKKTRIMCIIKELYGSGTERLRMETMTFETPSKKKLEISTISSNYHIEVNPSDVGIYDRVVVMDLVKTTAQTHQIDPNGQKEFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPSIKNIKDILHTICKREGLTLPDELATRLAETSGRNLRRAILMLEACKVEQYPFTADQNITEPDWQVYIRNTANMMVSEQSPKKLLAIRDRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHRMHKGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|66523693|ref|XP_624376.1| (replication factor C subunit 3 [Apis mellifera])

HSP 1 Score: 577.8 bits (1488), Expect = 3.100e-161
Identity = 278/351 (79.20%), Postives = 321/351 (91.45%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA  LKNM+QKGDFPHLLV+GP GAGKKTRIM II+ELYGSG ERLRME M FETPSKKKL+I TISSN+HIE+NPSDVGIYDRVV+MDL+KTTAQT+QIDP+GQ++FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP+   I+ IL  ICKREGL LPDELATRL+ TSGRNLRRAILMLEACKVEQYPFTA+Q ITEPDWQVYIR TA++MV+EQ+PKK+L +R+RLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMH+GSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQANYLKNMIQKGDFPHLLVYGPSGAGKKTRIMCIIKELYGSGTERLRMETMTFETPSKKKLEISTISSNYHIEVNPSDVGIYDRVVVMDLVKTTAQTHQIDPNGQKEFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPSIKNIKDILHTICKREGLTLPDELATRLAETSGRNLRRAILMLEACKVEQYPFTADQNITEPDWQVYIRNTANMMVSEQSPKKLLAIRDRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHRMHKGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|1035618623|ref|XP_016917173.1| (replication factor C subunit 3 [Apis cerana] >gi|1035618625|ref|XP_016917174.1| replication factor C subunit 3 [Apis cerana] >gi|1035618627|ref|XP_016917175.1| replication factor C subunit 3 [Apis cerana] >gi|1241831393|gb|PBC27781.1| Replication factor C subunit [Apis cerana cerana])

HSP 1 Score: 577.4 bits (1487), Expect = 4.000e-161
Identity = 277/351 (78.92%), Postives = 321/351 (91.45%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA  LKNM+QKGDFPHLLV+GP GAGKKTRIM II+ELYGSG ERLRME M FETPSKKKL+I TISSN+HIE+NPSDVGIYDRVV+MDL+KTTAQT+QIDP+GQ++FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP+   I+ IL  ICKREGL LPDELATRL+ TSGRNLRRAILMLEACKVEQYPFTA+Q ITEPDWQ+YIR TA++MV+EQ+PKK+L +R+RLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMH+GSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQANYLKNMIQKGDFPHLLVYGPSGAGKKTRIMCIIKELYGSGTERLRMETMTFETPSKKKLEISTISSNYHIEVNPSDVGIYDRVVVMDLVKTTAQTHQIDPNGQKEFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPSIKNIKDILHTICKREGLTLPDELATRLAETSGRNLRRAILMLEACKVEQYPFTADQNITEPDWQIYIRNTANMMVSEQSPKKLLAIRDRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHRMHKGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|820852439|ref|XP_003694797.2| (PREDICTED: LOW QUALITY PROTEIN: replication factor C subunit 3 [Apis florea])

HSP 1 Score: 575.9 bits (1483), Expect = 1.200e-160
Identity = 276/351 (78.63%), Postives = 320/351 (91.17%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA  LKNM+QKGDFPHLLV+GP GAGKKTRIM II+ELYGSG ERLRME M FETPSKKKL+I TISSN+HIE+NPSDVGIYDR+V+MDL+KTTAQT+QIDP+GQ++FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP+   I+ IL  ICKREGL LPDELATRL+ TSGRNLRRAILMLEACKVEQYPFT +Q ITEPDWQVYIR TA++MV+EQ+PKK+L +R+RLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMH+GSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQANYLKNMIQKGDFPHLLVYGPSGAGKKTRIMCIIKELYGSGTERLRMETMTFETPSKKKLEISTISSNYHIEVNPSDVGIYDRIVVMDLVKTTAQTHQIDPNGQKEFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPSIKNIKDILHTICKREGLTLPDELATRLAETSGRNLRRAILMLEACKVEQYPFTGDQNITEPDWQVYIRNTANMMVSEQSPKKLLAIRDRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHRMHKGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|939665907|ref|XP_014297817.1| (PREDICTED: replication factor C subunit 3 [Microplitis demolitor])

HSP 1 Score: 575.1 bits (1481), Expect = 2.000e-160
Identity = 275/353 (77.90%), Postives = 323/353 (91.50%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAVGD 354
            MSLWVDKYRP+SL+KLDYH EQA+ LKNMVQK DFPHLLVHGPPGAGKKTRIM+IIRELYG GVERLRME MQFETPSKKK+++MTISSN+HIE+NPSDVGIYDR+VIMDL+KTTAQT+QID +GQRDFKVV+LTNVDQLT+DAQHALRRTMEKY+T+CRLILCAN+TSRV PAIRSRCLG+R+ APT  EI+S+L  I K+E + LPDELA+RL+ +SGRNLRRAILMLEACKVEQYPFT +Q+ITEPDWQ +IRKTA++MV EQTP+K+L++R RLYELLTHAIPCD+IF+GL+QE  KNCDL++K EI  +AAE+EHRMHRGSK IFHLEAFVA+FM +YK++M  A+ D
Sbjct:    1 MSLWVDKYRPSSLNKLDYHTEQAEHLKNMVQKSDFPHLLVHGPPGAGKKTRIMAIIRELYGPGVERLRMEPMQFETPSKKKIELMTISSNYHIEVNPSDVGIYDRIVIMDLVKTTAQTHQIDINGQRDFKVVLLTNVDQLTKDAQHALRRTMEKYITTCRLILCANSTSRVLPAIRSRCLGIRVPAPTIDEIKSVLHIISKKESIILPDELASRLALSSGRNLRRAILMLEACKVEQYPFTPDQQITEPDWQSFIRKTAAMMVTEQTPRKLLDIRGRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKAEIVLVAAEFEHRMHRGSKAIFHLEAFVAKFMTIYKKFMDVAMDD 353          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|1059228998|ref|XP_017759891.1| (PREDICTED: replication factor C subunit 3 [Eufriesea mexicana] >gi|1059229000|ref|XP_017759892.1| PREDICTED: replication factor C subunit 3 [Eufriesea mexicana] >gi|1026565835|gb|OAD55317.1| Replication factor C subunit 3 [Eufriesea mexicana])

HSP 1 Score: 573.9 bits (1478), Expect = 4.400e-160
Identity = 277/351 (78.92%), Postives = 319/351 (90.88%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA+ LKNMVQKGDFPHLLV+GP GAGKKTRIM II+ELYG+G+ERLRME M FET SKKKL+I TISSN+HIE+NPSDVGIYDR V+MDL+KTTAQT+QIDPSGQR+FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP   +I+ IL  ICKREGL LPDELA RL+ TSGRNLRRAILMLEACKVE YPFTA+Q ITEPDWQVYIR TA++MV+EQ+PKK+L +RNRLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEHRMHRG+K IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQAEYLKNMVQKGDFPHLLVYGPSGAGKKTRIMCIIKELYGNGIERLRMETMTFETLSKKKLEITTISSNYHIEVNPSDVGIYDRTVVMDLVKTTAQTHQIDPSGQREFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPAVSDIKDILHSICKREGLTLPDELAVRLAETSGRNLRRAILMLEACKVESYPFTADQNITEPDWQVYIRNTANMMVSEQSPKKLLAIRNRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATIAAEYEHRMHRGTKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|1059863598|ref|XP_017798548.1| (PREDICTED: replication factor C subunit 3 [Habropoda laboriosa] >gi|915666706|gb|KOC68570.1| Replication factor C subunit 3 [Habropoda laboriosa])

HSP 1 Score: 573.5 bits (1477), Expect = 5.800e-160
Identity = 277/351 (78.92%), Postives = 320/351 (91.17%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAV 352
            MSLWVDKYRPT+L KLDYH EQA+ LKNMVQKGDFPHLLV+GP GAGKKTRIM  I+ELYGSGVERLRME M F+TPSKKKL I TISSN+HIE+NPSDVGIYDRVV+MDL+KTTAQT+QIDPSGQR+FKVV+LTNVDQLT+DAQHALRRTMEKYV +CRLILCAN+TSRV PAIRSRCLG+R+ AP+  +I+ IL  ICKREGL LP+ELA R++ TSGRNLRRAILMLEACKVEQYPFTA+Q I+EPDWQVYIR TA++MV EQ+P K+LE+RNRLYELLTHAIPCD+IF+GL+QE  KNCDL++K EIA +AAEYEH+MHRGSK IFHLEAFVARFMA+YK+++ S++
Sbjct:    1 MSLWVDKYRPTTLGKLDYHKEQAEYLKNMVQKGDFPHLLVYGPSGAGKKTRIMCTIKELYGSGVERLRMETMTFQTPSKKKLDITTISSNYHIEVNPSDVGIYDRVVVMDLVKTTAQTHQIDPSGQREFKVVLLTNVDQLTKDAQHALRRTMEKYVATCRLILCANSTSRVLPAIRSRCLGIRVPAPSISDIKYILHSICKREGLTLPNELAVRIAATSGRNLRRAILMLEACKVEQYPFTADQNISEPDWQVYIRNTANMMVIEQSPTKLLEIRNRLYELLTHAIPCDLIFKGLLQECIKNCDLQLKIEIATVAAEYEHKMHRGSKPIFHLEAFVARFMAIYKKFIDSSL 351          
BLAST of g45.t1 vs. GenBank_protein
Match: gi|755965943|ref|XP_011305339.1| (PREDICTED: replication factor C subunit 3 isoform X1 [Fopius arisanus])

HSP 1 Score: 570.5 bits (1469), Expect = 4.900e-159
Identity = 275/353 (77.90%), Postives = 322/353 (91.22%), Query Frame = 0
Query:    1 MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKTRIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDVGIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRRTMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHICKREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPDWQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELAKNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASAVGD 354
            MSLWVDK+RPTSLSKLDYH EQA+ LKNMVQKGDFPHLLVHGPPGAGKKTRIM+IIRELYGSGVERLRME MQFETPSKKKL+IMTISSN+HIE+NPSDVGIYDRVVIMDL+KTTAQT+QID +GQR+FKVV+LTNVDQLT+DAQHALRRTMEKYV++CRLILCAN+TSRV PAIRSRCL +R+ APT  EI+SIL+ + K+EGLNLPD LA  +++ S RNLRRA+LMLEACKVEQYPFT +Q+ITEPDW+V++ KTA++MV EQTP+K+L++R RLYELLTHAIPCD+IF+GL+QE  KNCDL +K EI   AAE+EHRMH GSK IFHLEAFVARFMA+YK++M +++ D
Sbjct:    1 MSLWVDKHRPTSLSKLDYHTEQAEHLKNMVQKGDFPHLLVHGPPGAGKKTRIMAIIRELYGSGVERLRMEPMQFETPSKKKLEIMTISSNYHIEVNPSDVGIYDRVVIMDLVKTTAQTHQIDINGQREFKVVLLTNVDQLTKDAQHALRRTMEKYVSTCRLILCANSTSRVLPAIRSRCLAIRVPAPTIPEIKSILQLVAKKEGLNLPDGLAENVAKASERNLRRALLMLEACKVEQYPFTNDQKITEPDWKVFLCKTATMMVTEQTPRKLLDIRGRLYELLTHAIPCDLIFKGLLQECIKNCDLPLKSEIVAAAAEFEHRMHHGSKPIFHLEAFVARFMAVYKKFMDASMND 353          
The following BLAST results are available for this feature:
BLAST of g45.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|987903135|ref|XP_015439041.1|8.100e-16279.20PREDICTED: replication factor C subunit 3 [Dufoure... [more]
gi|350424978|ref|XP_003493974.1|1.100e-16179.49replication factor C subunit 3 [Bombus impatiens][more]
gi|572304958|ref|XP_006618427.1|3.100e-16179.20PREDICTED: replication factor C subunit 3-like iso... [more]
gi|66523693|ref|XP_624376.1|3.100e-16179.20replication factor C subunit 3 [Apis mellifera][more]
gi|1035618623|ref|XP_016917173.1|4.000e-16178.92replication factor C subunit 3 [Apis cerana] >gi|1... [more]
gi|820852439|ref|XP_003694797.2|1.200e-16078.63PREDICTED: LOW QUALITY PROTEIN: replication factor... [more]
gi|939665907|ref|XP_014297817.1|2.000e-16077.90PREDICTED: replication factor C subunit 3 [Micropl... [more]
gi|1059228998|ref|XP_017759891.1|4.400e-16078.92PREDICTED: replication factor C subunit 3 [Eufries... [more]
gi|1059863598|ref|XP_017798548.1|5.800e-16078.92PREDICTED: replication factor C subunit 3 [Habropo... [more]
gi|755965943|ref|XP_011305339.1|4.900e-15977.90PREDICTED: replication factor C subunit 3 isoform ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006260 DNA replication
molecular_function GO:0003677 DNA binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 34..190
e-value: 2.5E-4
score: 30.4
NoneNo IPR availableGENE3D1.20.272.10coord: 252..344
e-value: 3.9E-34
score: 118.7
NoneNo IPR availableGENE3D1.10.8.60coord: 191..251
e-value: 2.0E-7
score: 32.5
NoneNo IPR availablePFAMPF13177DNA_pol3_delta2coord: 21..185
e-value: 3.0E-10
score: 40.1
NoneNo IPR availableGENE3D3.40.50.300coord: 1..187
e-value: 1.7E-51
score: 176.9
NoneNo IPR availablePANTHERPTHR11669REPLICATION FACTOR C / DNA POLYMERASE III GAMMA-TAU SUBUNITcoord: 3..347
NoneNo IPR availablePANTHERPTHR11669:SF1REPLICATION FACTOR C SUBUNIT 3coord: 3..347
NoneNo IPR availableCDDcd00009AAAcoord: 21..179
e-value: 4.87168E-6
score: 43.6739
IPR013748Replication factor C, C-terminalPFAMPF08542Rep_fac_Ccoord: 262..338
e-value: 9.7E-6
score: 25.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILY52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..235
IPR008921DNA polymerase III, clamp loader complex, gamma/delta/delta subunit, C-terminalSUPERFAMILY48019post-AAA+ oligomerization domain-likecoord: 248..344

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:357117..358664 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g45.t1g45.t1Venturia canescensmRNAscaffold_1 357117..358664 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g45.t1-PA ID=g45.t1-PA|Name=g45.t1|organism=Venturia canescens|type=polypeptide|length=355bp
MSLWVDKYRPTSLSKLDYHLEQAKDLKNMVQKGDFPHLLVHGPPGAGKKT
RIMSIIRELYGSGVERLRMENMQFETPSKKKLQIMTISSNFHIEINPSDV
GIYDRVVIMDLIKTTAQTYQIDPSGQRDFKVVILTNVDQLTRDAQHALRR
TMEKYVTSCRLILCANTTSRVSPAIRSRCLGVRIAAPTFVEIESILRHIC
KREGLNLPDELATRLSRTSGRNLRRAILMLEACKVEQYPFTAEQEITEPD
WQVYIRKTASIMVAEQTPKKILEVRNRLYELLTHAIPCDVIFRGLVQELA
KNCDLEMKGEIAEMAAEYEHRMHRGSKVIFHLEAFVARFMALYKEYMASA
VGDEF
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006260DNA replication
Vocabulary: INTERPRO
TermDefinition
IPR003593AAA+_ATPase
IPR013748Rep_factorC_C
IPR027417P-loop_NTPase
IPR008921DNA_pol3_clamp-load_cplx_C