g4592.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg4592.t1
Unique Nameg4592.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length35
Homology
The following BLAST results are available for this feature:
BLAST of g4592.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 27..35
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..9
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 10..21
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..26
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 22..26

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_18568contigscaffold_18568:213..317 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g4592.t1g4592.t1Venturia canescensmRNAscaffold_18568 1..317 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g4592.t1-PA ID=g4592.t1-PA|Name=g4592.t1|organism=Venturia canescens|type=polypeptide|length=35bp
MHPLLRIDSIAAVTSFPLLLFNGAAQANLENISMT
back to top