g5376.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg5376.t1
Unique Nameg5376.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length36
Homology
The following BLAST results are available for this feature:
BLAST of g5376.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 24..36
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 19..23
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 7..18
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..23
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..6

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_38716contigscaffold_38716:31..140 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g5376.t1g5376.t1Venturia canescensmRNAscaffold_38716 1..140 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g5376.t1-PA ID=g5376.t1-PA|Name=g5376.t1|organism=Venturia canescens|type=polypeptide|length=36bp
MRFSSPTTGSWLLPGSAIPSVVALRCSRRGSTIPVP
back to top