g5937.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg5937.t1
Unique Nameg5937.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length37
Homology
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|307209238|gb|EFN86345.1| (G protein-coupled receptor kinase 1 [Harpegnathos saltator])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|332017080|gb|EGI57879.1| (G protein-coupled receptor kinase 1 [Acromyrmex echinatior])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1483681327|ref|XP_026327454.1| (G protein-coupled receptor kinase 1 isoform X1 [Hyposmocoma kahamanoa])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1483681329|ref|XP_026327455.1| (G protein-coupled receptor kinase 1 isoform X2 [Hyposmocoma kahamanoa])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1486932695|ref|XP_026499706.1| (G protein-coupled receptor kinase 1 isoform X2 [Vanessa tameamea])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1486932693|ref|XP_026499705.1| (G protein-coupled receptor kinase 1 isoform X1 [Vanessa tameamea])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1496249024|ref|XP_026735160.1| (G protein-coupled receptor kinase 1 isoform X2 [Trichoplusia ni])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1496249022|ref|XP_026735159.1| (G protein-coupled receptor kinase 1 isoform X1 [Trichoplusia ni])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1567613434|ref|XP_027846787.1| (G protein-coupled receptor kinase 1 isoform X1 [Aphis gossypii] >gi|1567613436|ref|XP_027846789.1| G protein-coupled receptor kinase 1 isoform X1 [Aphis gossypii])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
BLAST of g5937.t1 vs. GenBank_protein
Match: gi|1567613438|ref|XP_027846790.1| (G protein-coupled receptor kinase 1 isoform X2 [Aphis gossypii])

HSP 1 Score: 72.4 bits (176), Expect = 4.400e-10
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 0
Query:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 38
            MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
Sbjct:    1 MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP 37          
The following BLAST results are available for this feature:
BLAST of g5937.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|307209238|gb|EFN86345.1|4.400e-10100.00G protein-coupled receptor kinase 1 [Harpegnathos ... [more]
gi|332017080|gb|EGI57879.1|4.400e-10100.00G protein-coupled receptor kinase 1 [Acromyrmex ec... [more]
gi|1483681327|ref|XP_026327454.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X1 [Hy... [more]
gi|1483681329|ref|XP_026327455.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X2 [Hy... [more]
gi|1486932695|ref|XP_026499706.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X2 [Va... [more]
gi|1486932693|ref|XP_026499705.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X1 [Va... [more]
gi|1496249024|ref|XP_026735160.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X2 [Tr... [more]
gi|1496249022|ref|XP_026735159.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X1 [Tr... [more]
gi|1567613434|ref|XP_027846787.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X1 [Ap... [more]
gi|1567613438|ref|XP_027846790.1|4.400e-10100.00G protein-coupled receptor kinase 1 isoform X2 [Ap... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006468 protein phosphorylation
biological_process GO:0007165 signal transduction
molecular_function GO:0005524 ATP binding
molecular_function GO:0004703 G-protein coupled receptor kinase activity
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR24355:SF18G PROTEIN-COUPLED RECEPTOR KINASEcoord: 1..37
NoneNo IPR availablePANTHERPTHR24355G PROTEIN-COUPLED RECEPTOR KINASE/RIBOSOMAL PROTEIN S6 KINASEcoord: 1..37

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_62contigscaffold_62:454..566 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g5937.t1g5937.t1Venturia canescensmRNAscaffold_62 1..566 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g5937.t1-PA ID=g5937.t1-PA|Name=g5937.t1|organism=Venturia canescens|type=polypeptide|length=37bp
MADLEAVLADVSYLMAMEKSKCTPAARASKKIVLPDP
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0004703G-protein coupled receptor kinase activity