g69.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg69.t1
Unique Nameg69.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length406
Homology
BLAST of g69.t1 vs. GenBank_protein
Match: gi|1000743877|ref|XP_015594631.1| (protein arginine methyltransferase NDUFAF7, mitochondrial isoform X1 [Cephus cinctus])

HSP 1 Score: 548.9 bits (1413), Expect = 1.800e-152
Identity = 252/403 (62.53%), Postives = 333/403 (82.63%), Query Frame = 0
Query:    5 AKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSKK-DNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNPQQEALKK 407
            +K+ +LF+ L+A+I ACGPITVADYMKEVLTHPTAGYYMN+DVFG+ GDFITSPEI+Q+FGEM+G+WI+NE SKI+   FQLVELGPGRGTL KDILRV K+LK+I + S+HLVE+SP LS IQ++ LC S++E     +K  +NS+SHYR+G+T +G+K+FWY SI D+P+ FS+F+AHEFFDALPIHKFQ+T + W EVL+DIDP   N++KFRYV+++ ATP+   +VS +E RDH+EVSPQ+IVI D+++SFL E GGF LIADYGH+GEKTDTFR+FR+H+ +DPL+ PGTADLTADVDFSL  R+   +++LI+FGP++Q  FLK LGID+RL+MLL+NA +++R  I+S YHMI DED+MG  FK+ S FP++L+ +  +WPV+GF   + + LKK
Sbjct:   74 SKQPSLFQQLSARIMACGPITVADYMKEVLTHPTAGYYMNKDVFGEKGDFITSPEITQIFGEMLGVWIINEWSKISRGPFQLVELGPGRGTLSKDILRVFKQLKIIDKVSLHLVEVSPTLSAIQAKNLCTSTEEVNPLTNKNGENSISHYRKGITNDGVKIFWYYSITDVPRDFSIFLAHEFFDALPIHKFQRTSEGWREVLVDIDPVANNQEKFRYVISRMATPSVKAYVSENEPRDHLEVSPQSIVIADHLSSFLYENGGFVLIADYGHDGEKTDTFRAFRQHQLHDPLINPGTADLTADVDFSLFKRIASNDNKLITFGPINQRDFLKQLGIDIRLQMLLRNAPEDQRDQIQSAYHMITDEDQMGKCFKMLSMFPAILKKHFEKWPVSGFQ--KIDGLKK 474          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|1389727613|ref|XP_024940398.1| (protein arginine methyltransferase NDUFAF7 homolog, mitochondrial isoform X2 [Cephus cinctus])

HSP 1 Score: 548.9 bits (1413), Expect = 1.800e-152
Identity = 252/403 (62.53%), Postives = 333/403 (82.63%), Query Frame = 0
Query:    5 AKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSKK-DNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNPQQEALKK 407
            +K+ +LF+ L+A+I ACGPITVADYMKEVLTHPTAGYYMN+DVFG+ GDFITSPEI+Q+FGEM+G+WI+NE SKI+   FQLVELGPGRGTL KDILRV K+LK+I + S+HLVE+SP LS IQ++ LC S++E     +K  +NS+SHYR+G+T +G+K+FWY SI D+P+ FS+F+AHEFFDALPIHKFQ+T + W EVL+DIDP   N++KFRYV+++ ATP+   +VS +E RDH+EVSPQ+IVI D+++SFL E GGF LIADYGH+GEKTDTFR+FR+H+ +DPL+ PGTADLTADVDFSL  R+   +++LI+FGP++Q  FLK LGID+RL+MLL+NA +++R  I+S YHMI DED+MG  FK+ S FP++L+ +  +WPV+GF   + + LKK
Sbjct:   16 SKQPSLFQQLSARIMACGPITVADYMKEVLTHPTAGYYMNKDVFGEKGDFITSPEITQIFGEMLGVWIINEWSKISRGPFQLVELGPGRGTLSKDILRVFKQLKIIDKVSLHLVEVSPTLSAIQAKNLCTSTEEVNPLTNKNGENSISHYRKGITNDGVKIFWYYSITDVPRDFSIFLAHEFFDALPIHKFQRTSEGWREVLVDIDPVANNQEKFRYVISRMATPSVKAYVSENEPRDHLEVSPQSIVIADHLSSFLYENGGFVLIADYGHDGEKTDTFRAFRQHQLHDPLINPGTADLTADVDFSLFKRIASNDNKLITFGPINQRDFLKQLGIDIRLQMLLRNAPEDQRDQIQSAYHMITDEDQMGKCFKMLSMFPAILKKHFEKWPVSGFQ--KIDGLKK 416          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|817203317|ref|XP_012277477.1| (protein arginine methyltransferase NDUFAF7, mitochondrial [Orussus abietinus])

HSP 1 Score: 537.7 bits (1384), Expect = 4.000e-149
Identity = 249/394 (63.20%), Postives = 325/394 (82.49%), Query Frame = 0
Query:    4 EAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK-KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGF 397
            ++++  L++ +  KI ACGPITVA+YMK VLTHP AGYY ++DVFGQ GDF TSPEISQLFGEMI +WI+NE +KIT + FQLVELGPGRG+L +DI+RV K+LK   + S+H VEISP LS IQ++ LCVSSKE    V+K + N+V+HYR+G+TEEG+++FWY SI D+P+KFSVF+AHEFFD LP+HKFQKT   WNE+LIDIDP + +++KFRYVL+  +T AS I+VS DEKRDH+E+ PQ +V +DYMAS L+E GGFALIADYGHNGEKTDTFR+FR+H+ +DPL++PG+ADLTADVDFSL+ ++ +K  RLI+FGP++Q +FLK LGID+RL +LL +ASD ++  ++SGYHMI D+DKMG  FK+ S FP VL+ +L ++PVAGF
Sbjct:   41 KSEKNLLYREIFTKIMACGPITVAEYMKTVLTHPVAGYYTSKDVFGQKGDFTTSPEISQLFGEMIAVWIINEWNKITNNEFQLVELGPGRGSLARDIIRVFKQLKYTSKLSLHFVEISPVLSDIQAKNLCVSSKEVKPEVNKNQKNAVTHYRKGITEEGVQIFWYYSINDVPRKFSVFIAHEFFDTLPVHKFQKTDRGWNEILIDIDPLSVDQEKFRYVLSGTSTSASIIYVSEDEKRDHIEICPQAMVTLDYMASCLKECGGFALIADYGHNGEKTDTFRAFRQHKLHDPLVQPGSADLTADVDFSLLRKIAQKNERLITFGPVNQGNFLKELGIDIRLNVLLNSASDNQKEQLKSGYHMITDDDKMGKCFKMLSLFPCVLKEHLQKFPVAGF 434          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|954563644|ref|XP_014605696.1| (PREDICTED: NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 [Polistes canadensis])

HSP 1 Score: 537.7 bits (1384), Expect = 4.000e-149
Identity = 249/394 (63.20%), Postives = 325/394 (82.49%), Query Frame = 0
Query:    6 KEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK---KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGF 397
            K+  L++ L +K+  CGP++VA+YMKE+LTHP  GYYM +DVFG  GDFITSPEISQLFGE+I +WI+NE  KI++D FQL+ELGPG+GTL +D+LRV K+LK +++ SIHLVEISPALSKIQ++ LC   +E   A SK   K+NS+ HY++G+TE+GI+++WY S+ DIPKKFS+F+AHEFFDALPIHKFQKT   W+EVL+D+ P  E E+KFRYVL+K  TPA+ +++S DE RDHVE+SPQ+IVIIDY++SFL E+GGFALI DYGH  +KTDTFR+F++H+ +DPL+ PG+ADLTADVDFSLI ++  K++++ISFGP+ Q +FLKNLGID+RLEM+LKN++D ++ HI SGYHMIMD DKMG RFKV S FP VL  Y+ +W V GF
Sbjct:   48 KKSPLYRQLYSKMMTCGPLSVAEYMKEILTHPNVGYYMTKDVFGLKGDFITSPEISQLFGEIIAVWIINEWIKISKDPFQLIELGPGKGTLIQDVLRVFKKLKFLNKISIHLVEISPALSKIQAQNLCTHIEEINLADSKTQTKENSIGHYKKGITEDGIEIYWYYSVTDIPKKFSIFLAHEFFDALPIHKFQKTDQGWSEVLVDVIPGIE-EEKFRYVLSKGLTPAAKVYISEDESRDHVEISPQSIVIIDYISSFLMEYGGFALIIDYGHVADKTDTFRAFQKHKLHDPLLNPGSADLTADVDFSLIKKIALKDNKVISFGPISQRTFLKNLGIDLRLEMILKNSTDVQKEHILSGYHMIMDADKMGERFKVLSLFPYVLSKYIDKWKVDGF 440          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|571514681|ref|XP_006568862.1| (protein arginine methyltransferase NDUFAF7, mitochondrial isoform X1 [Apis mellifera])

HSP 1 Score: 535.4 bits (1378), Expect = 2.000e-148
Identity = 254/394 (64.47%), Postives = 324/394 (82.23%), Query Frame = 0
Query:    4 EAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK-KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGF 397
            + K  +L+ HL +KI ACGPITVADYMKEVLTHP  GYYMN+DVFG+ GDFITSPEISQLFGEM+ +W+  E  KI++DSFQ+VELGPGRGTL KDILRV K+ K ++  SIHLVE+SP LS+IQ++ LC +  E  Q  +K K+NS S+Y+EG+TE+GIK++WY SIKD+PKKFS+F+AHEFFDALPIHKFQK  + W EVLIDI     NE+KFRYVL+   TPA+ +F+S DEKR+H+E+SP++++I+DY+A FL E GGFALI DYGHNG+KTDTFR F +H+ +DPL+ PGTADLTADVDF+ I ++  K++RLI+FGP+ Q +FL+NLGI+VRL++LL+NAS EER  +ESGYHMIMD+DKMG RFKV S FPS+L+ Y  + P+AGF
Sbjct:   10 DKKSKSLYHHLYSKILACGPITVADYMKEVLTHPIIGYYMNKDVFGKQGDFITSPEISQLFGEMLAVWMKYEWQKISKDSFQIVELGPGRGTLIKDILRVFKQFKSLNDISIHLVEVSPILSQIQAKNLCKTIIEYDQKKNKSKNNSTSYYKEGITEDGIKLYWYHSIKDVPKKFSIFLAHEFFDALPIHKFQKIDNEWREVLIDIIQGC-NEEKFRYVLSNTPTPAT-LFISNDEKREHIEISPESLIIVDYLADFLWECGGFALICDYGHNGDKTDTFRGFSQHKVHDPLLHPGTADLTADVDFAAIKKIAEKDNRLITFGPVSQSNFLQNLGINVRLQILLQNASKEERKSLESGYHMIMDKDKMGIRFKVLSLFPSILKEYFKKIPIAGF 401          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|972206093|ref|XP_015185296.1| (PREDICTED: NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 isoform X1 [Polistes dominula])

HSP 1 Score: 534.6 bits (1376), Expect = 3.400e-148
Identity = 252/405 (62.22%), Postives = 328/405 (80.99%), Query Frame = 0
Query:    6 KEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK---KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNP-QQEALKK 407
            K+  L++ L +K+  CGP++VA+YMKE+LTHP  GYYM +DVFG  GDFITSPEISQLFGE+I +WI+NE  KI++D FQLVELGPG+GTL +D+LRV K+L+ +++ SIHLVEISPALSKIQ++ LC   +E   A SK   K+NS+ HY++G+TE+GI+++WY S+ DIPKKFS+F+AHEFFDALPIHKFQKT   W+EVL+D+ P  E E+KFRYVL+K  TPA+ +++S DE RDHVE+SPQ++VIIDY++SFL E GGFALI DYGH  +KTDTFR+FR+H+ +DPL+ PG+ADLTADVDFSLI ++  K++R+ISFGP+ Q +FLKNLGID+RLEM+LKN++D ++  I SGYHMIMD DKMG RFKV S FP VL  Y+ +W V GF    + E L+K
Sbjct:   69 KKSPLYRQLYSKMMTCGPLSVAEYMKEILTHPNVGYYMTKDVFGLKGDFITSPEISQLFGEIIAVWIINEWIKISKDPFQLVELGPGKGTLIQDVLRVFKKLQFLNKISIHLVEISPALSKIQAQNLCTHVEEINLADSKTQIKENSIGHYKKGITEDGIEIYWYYSVTDIPKKFSIFLAHEFFDALPIHKFQKTDQGWSEVLVDVIPGIE-EEKFRYVLSKGLTPAARVYISEDESRDHVEISPQSLVIIDYISSFLMECGGFALIIDYGHIADKTDTFRAFRKHKLHDPLLNPGSADLTADVDFSLIQKIALKDNRVISFGPISQRTFLKNLGIDLRLEMILKNSTDVQKEQILSGYHMIMDADKMGERFKVLSLFPYVLSKYMDKWKVDGFKQENKNEQLQK 472          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|972206095|ref|XP_015185297.1| (PREDICTED: NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 isoform X2 [Polistes dominula])

HSP 1 Score: 534.6 bits (1376), Expect = 3.400e-148
Identity = 252/405 (62.22%), Postives = 328/405 (80.99%), Query Frame = 0
Query:    6 KEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK---KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNP-QQEALKK 407
            K+  L++ L +K+  CGP++VA+YMKE+LTHP  GYYM +DVFG  GDFITSPEISQLFGE+I +WI+NE  KI++D FQLVELGPG+GTL +D+LRV K+L+ +++ SIHLVEISPALSKIQ++ LC   +E   A SK   K+NS+ HY++G+TE+GI+++WY S+ DIPKKFS+F+AHEFFDALPIHKFQKT   W+EVL+D+ P  E E+KFRYVL+K  TPA+ +++S DE RDHVE+SPQ++VIIDY++SFL E GGFALI DYGH  +KTDTFR+FR+H+ +DPL+ PG+ADLTADVDFSLI ++  K++R+ISFGP+ Q +FLKNLGID+RLEM+LKN++D ++  I SGYHMIMD DKMG RFKV S FP VL  Y+ +W V GF    + E L+K
Sbjct:   49 KKSPLYRQLYSKMMTCGPLSVAEYMKEILTHPNVGYYMTKDVFGLKGDFITSPEISQLFGEIIAVWIINEWIKISKDPFQLVELGPGKGTLIQDVLRVFKKLQFLNKISIHLVEISPALSKIQAQNLCTHVEEINLADSKTQIKENSIGHYKKGITEDGIEIYWYYSVTDIPKKFSIFLAHEFFDALPIHKFQKTDQGWSEVLVDVIPGIE-EEKFRYVLSKGLTPAARVYISEDESRDHVEISPQSLVIIDYISSFLMECGGFALIIDYGHIADKTDTFRAFRKHKLHDPLLNPGSADLTADVDFSLIQKIALKDNRVISFGPISQRTFLKNLGIDLRLEMILKNSTDVQKEQILSGYHMIMDADKMGERFKVLSLFPYVLSKYMDKWKVDGFKQENKNEQLQK 452          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|820859167|ref|XP_003696905.2| (PREDICTED: NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog isoform X1 [Apis florea])

HSP 1 Score: 531.9 bits (1369), Expect = 2.200e-147
Identity = 253/394 (64.21%), Postives = 322/394 (81.73%), Query Frame = 0
Query:    4 EAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK-KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGF 397
            + K   L+ HL +KI ACGPITVADYMKEVLTHP  GYYMN+DVFG+ GDFITSPEISQLFGEM+ +W+  E  KI++DSFQ+VELGPGRGTL KDILRV K+ K ++  SIHLVE+SP LS+IQ+  LC +  E  Q  +K K+NS+S+Y+EG+TE+GIK++WY SIKD+PKKFS+F+AHEFFDALPIHKFQK  + W EVLIDI     NE+KF YVL+   TPA+ +F+S DEKR+H+E+SP++++I+DY+A FL E GGFALI DYGHNG+KTDTFR F +H+ +DPL+ PGTADLTADVDF+ I ++  K +RLI+FGP++Q +FL+NLGI++RL++LL+NAS EER  +ESGYHMIMD+DKMG RFKV S FPS+L+ Y  + PVAGF
Sbjct:   10 DKKSKNLYHHLYSKILACGPITVADYMKEVLTHPIIGYYMNKDVFGKQGDFITSPEISQLFGEMLAVWMKYEWQKISKDSFQIVELGPGRGTLIKDILRVFKQFKSLNDISIHLVEVSPILSQIQANNLCKTIIEYDQKRNKSKNNSISYYKEGITEDGIKLYWYRSIKDVPKKFSIFLAHEFFDALPIHKFQKIDNEWREVLIDIIQGC-NEEKFCYVLSNTPTPAT-LFISNDEKREHIEISPESLIIVDYLADFLWECGGFALICDYGHNGDKTDTFRGFSQHKIHDPLLHPGTADLTADVDFAAIKKIAEKNNRLITFGPLNQSNFLQNLGINIRLQILLQNASKEERKSLESGYHMIMDKDKMGIRFKVLSLFPSILKEYFKKIPVAGF 401          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|1153833374|ref|XP_020293288.1| (protein arginine methyltransferase NDUFAF7 homolog, mitochondrial isoform X1 [Pseudomyrmex gracilis])

HSP 1 Score: 527.7 bits (1358), Expect = 4.200e-146
Identity = 250/396 (63.13%), Postives = 317/396 (80.05%), Query Frame = 0
Query:    4 EAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK-KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSN 399
            + K+  L++ L AKI ACGPIT+A+YMK VLTHPT GYYM +DVFG  GDFITSPEISQLFGEM+ IWI+NE  KI++DS QLVELGPGRGTL  DILRV K+L L+ + S+HL+EISP LS IQ+EKLC+ S+ C   +S+ K  S+ HY+EG+T+EG+K++WY SIKD+PKKFSVF+AHEFFDALPIHKFQKT   W+EVLIDI  +   E+KF+YVL++  TPA   ++S  E+RDHVE+SP+ +V IDYM+ FL E GGFAL+ DYGH  EKTDTFR+FR+H+ +DPL++PGTADLTADVDF  +  +  K++R I FGP+ Q  FLK LGID+RL+M+L+NAS  ++  I+SGYHMI+DEDKMG  FKV  FFPS+L+ YL +WPVAGF+N
Sbjct:   43 DKKKSDLYRQLYAKILACGPITLAEYMKAVLTHPTVGYYMTKDVFGHRGDFITSPEISQLFGEMLAIWIINEWRKISKDSIQLVELGPGRGTLTNDILRVFKKLNLLDKISVHLIEISPILSTIQAEKLCIKSRNCESDISEDKTGSIMHYKEGVTKEGLKIYWYYSIKDVPKKFSVFIAHEFFDALPIHKFQKTDKGWSEVLIDI-IQGSKEEKFQYVLSQIPTPACKTYLSPSEERDHVEISPECLVTIDYMSQFLWECGGFALVIDYGHEREKTDTFRAFRQHKLHDPLLDPGTADLTADVDFLSMKEIAEKDNRSIVFGPITQREFLKCLGIDLRLKMILQNASVIQKQQIKSGYHMIIDEDKMGNCFKVLVFFPSILKNYLTKWPVAGFTN 437          
BLAST of g69.t1 vs. GenBank_protein
Match: gi|572309822|ref|XP_006620690.1| (PREDICTED: NADH dehydrogenase [ubiquinone] complex I, assembly factor 7 homolog isoform X1 [Apis dorsata])

HSP 1 Score: 526.6 bits (1355), Expect = 9.300e-146
Identity = 250/394 (63.45%), Postives = 320/394 (81.22%), Query Frame = 0
Query:    4 EAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQHGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDILRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSK-KDNSVSHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDIWNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTIVIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTADLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNASDEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGF 397
            + K   L+ HL +KI ACGPITVADYMKEVLTHP  GYYMN+DVFG+ GDFITSPEISQLFGEM+ +WI  E  KI++DSFQ+VELGPGRGTL KDILRV K+ K ++  SIHLVE+S  LS+IQ++ LC +  E  Q  +K K+NS+++Y+EG TE+GIK++WY SIKD+PKKFS+F+AHEFFDALPIHKFQK  + W EVLIDI     NE+KFRYVL+   TPA+ + +  DEKR+H+E+SP++++I+DY+A FL E GGFALI DYGHNG+KTDTFR F +H+ +DPL+ PGTADLTADVDF+ I ++  K++RLI+FGP+ Q +FL+NLGI++RL++LL+NAS EER  +ESGYHMIMD+DKMG RFKV S FPS+L+ Y  + P+AGF
Sbjct:   10 DKKSKNLYHHLYSKILACGPITVADYMKEVLTHPIIGYYMNKDVFGKQGDFITSPEISQLFGEMLAVWIKYEWQKISKDSFQIVELGPGRGTLIKDILRVFKQFKFLNDISIHLVEVSSILSQIQAKNLCKTIIEYDQKRNKSKNNSINYYKEGTTEDGIKLYWYYSIKDVPKKFSIFLAHEFFDALPIHKFQKIDNEWREVLIDIIQGC-NEEKFRYVLSNTPTPAT-LLIPSDEKREHIEISPESLIIVDYLADFLWECGGFALICDYGHNGDKTDTFRGFSQHKIHDPLLHPGTADLTADVDFAAIKKIAEKDNRLITFGPVSQSNFLQNLGINIRLQILLQNASKEERKSLESGYHMIMDKDKMGIRFKVLSLFPSILKEYFKKIPIAGF 401          
The following BLAST results are available for this feature:
BLAST of g69.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1000743877|ref|XP_015594631.1|1.800e-15262.53protein arginine methyltransferase NDUFAF7, mitoch... [more]
gi|1389727613|ref|XP_024940398.1|1.800e-15262.53protein arginine methyltransferase NDUFAF7 homolog... [more]
gi|817203317|ref|XP_012277477.1|4.000e-14963.20protein arginine methyltransferase NDUFAF7, mitoch... [more]
gi|954563644|ref|XP_014605696.1|4.000e-14963.20PREDICTED: NADH dehydrogenase [ubiquinone] complex... [more]
gi|571514681|ref|XP_006568862.1|2.000e-14864.47protein arginine methyltransferase NDUFAF7, mitoch... [more]
gi|972206093|ref|XP_015185296.1|3.400e-14862.22PREDICTED: NADH dehydrogenase [ubiquinone] complex... [more]
gi|972206095|ref|XP_015185297.1|3.400e-14862.22PREDICTED: NADH dehydrogenase [ubiquinone] complex... [more]
gi|820859167|ref|XP_003696905.2|2.200e-14764.21PREDICTED: NADH dehydrogenase [ubiquinone] complex... [more]
gi|1153833374|ref|XP_020293288.1|4.200e-14663.13protein arginine methyltransferase NDUFAF7 homolog... [more]
gi|572309822|ref|XP_006620690.1|9.300e-14663.45PREDICTED: NADH dehydrogenase [ubiquinone] complex... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003788Protein arginine methyltransferase NDUFAF7PFAMPF02636Methyltransf_28coord: 67..326
e-value: 1.2E-67
score: 228.3
IPR003788Protein arginine methyltransferase NDUFAF7PANTHERPTHR12049UNCHARACTERIZEDcoord: 4..380
IPR038375Protein arginine methyltransferase NDUFAF7 superfamilyGENE3D3.40.50.12710coord: 2..391
e-value: 5.2E-108
score: 363.2
NoneNo IPR availablePANTHERPTHR12049:SF7PROTEIN ARGININE METHYLTRANSFERASE NDUFAF7, MITOCHONDRIALcoord: 4..380
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILY53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 10..384

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:531963..533531 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g69.t1g69.t1Venturia canescensmRNAscaffold_1 531963..533531 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g69.t1-PA ID=g69.t1-PA|Name=g69.t1|organism=Venturia canescens|type=polypeptide|length=406bp
MPEEAKEYTLFKHLTAKIKACGPITVADYMKEVLTHPTAGYYMNRDVFGQ
HGDFITSPEISQLFGEMIGIWIVNELSKITEDSFQLVELGPGRGTLCKDI
LRVLKRLKLIHRASIHLVEISPALSKIQSEKLCVSSKECPQAVSKKDNSV
SHYREGLTEEGIKVFWYSSIKDIPKKFSVFVAHEFFDALPIHKFQKTGDI
WNEVLIDIDPKTENEKKFRYVLTKRATPASAIFVSRDEKRDHVEVSPQTI
VIIDYMASFLEEFGGFALIADYGHNGEKTDTFRSFRRHEQYDPLMEPGTA
DLTADVDFSLIDRVGRKESRLISFGPMDQCSFLKNLGIDVRLEMLLKNAS
DEERSHIESGYHMIMDEDKMGTRFKVFSFFPSVLEAYLAQWPVAGFSNPQ
QEALKK
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003788NDUFAF7
IPR038375NDUFAF7_sf
IPR029063SAM-dependent_MTases