g70.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg70.t1
Unique Nameg70.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length476
Homology
BLAST of g70.t1 vs. GenBank_protein
Match: gi|1000745824|ref|XP_015595663.1| (Golgi reassembly-stacking protein 2 [Cephus cinctus])

HSP 1 Score: 431.8 bits (1109), Expect = 3.700e-117
Identity = 258/418 (61.72%), Postives = 283/418 (67.70%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVNPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFS-QPASNYPHVGGVTSGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFY 418
            MGSSHSVEIPGGGTEGYHVLRVQ+ SPGQKAGLEAFFDFIV+I N RLDQDNDTLKE+LKAGV K+L +TVYNSKTQSVRQTVI PSMTWGG GLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLR FTDYII +DS LHESEDL++LIE HESR LKLYVYNT +D+CREVTITPN+TWGGEGSLGCGIGYGYLHRIP+RSI E    +   +    +  Q  P+                                       T            XXXX        P LDPA+AGA  TTN   HLFS Q   N+PH    + GYQ+T  XXXXXXXXXXXXXXX ++   G     NP    + SI   IP        +P +VTTPI LPGMPPITVSASLPQ   FY
Sbjct:    1 MGSSHSVEIPGGGTEGYHVLRVQDGSPGQKAGLEAFFDFIVAIGNIRLDQDNDTLKELLKAGVDKDLQITVYNSKTQSVRQTVIVPSMTWGGQGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRSFTDYIISTDSVLHESEDLFTLIETHESRPLKLYVYNTNDDSCREVTITPNNTWGGEGSLGCGIGYGYLHRIPIRSIPEAKPNSYLSN-AKTITTQAQPA---TSTGSNLVTNVPTGYSMPPSYVSVAVSESTAKDSIITTAPQNIQSPVPAXXXXSIATTNAVPQLDPAIAGALPTTNSATHLFSAQSNINFPHATSQSPGYQNTXXXXXXXXXXXXXXXXXSVATLPGG----NPVSQPNASIMGGIPS-----EYQPHVVTTPISLPGMPPITVSASLPQNPTFY 405          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|665800206|ref|XP_008548056.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Microplitis demolitor] >gi|665800208|ref|XP_008548057.1| PREDICTED: Golgi reassembly-stacking protein 2 [Microplitis demolitor])

HSP 1 Score: 418.7 bits (1075), Expect = 3.200e-113
Identity = 257/431 (59.63%), Postives = 291/431 (67.52%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPH-----LVNPVAAQVSP----SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFSQPASNYPHVGGVTSGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYD---PSIPSVIPGMTSYMPSEP--SIVTTPIELPGMPPITVSASLPQTAAFY 418
            MGSS S+E+PGGGTEGYHVLRVQ  SPG KAGLEAFFDFIVSI N RLDQDNDTLK+ILK  + KEL +TVYNSK Q+VRQT I PSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLR FTDYIIG+DSALHESEDL++LIEAHE+R LKLYVYNT +D+CREVTITPNS WGGEGSLGCGIGYGYLHRIP+R++ +      +P+     +  P+AAQ  P      XXXXXXXXXXXXXXXXXXXX                                             +DPA+AGASTTTNP  + F+QP  NY      +S YQ+TPS               + S+P  S     P   Y    P++P      TS +P  P   +VTTPI LPGMPPITVSASLPQT+ F+
Sbjct:    1 MGSSQSLEVPGGGTEGYHVLRVQAGSPGYKAGLEAFFDFIVSIGNIRLDQDNDTLKDILKTNIDKELQLTVYNSKNQTVRQTTIVPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRSFTDYIIGADSALHESEDLFTLIEAHEARPLKLYVYNTTDDSCREVTITPNSKWGGEGSLGCGIGYGYLHRIPVRNLFDNK---MYPNSYQTTVKTPIAAQAQPVNYEPQXXXXXXXXXXXXXXXXXXXXMSTSSGIMQPADTTVVSSIATPTIPISTVPVPQTMPIDASAPPKFIDPAIAGASTTTNPAVNFFNQP--NYSQ---NSSMYQNTPSIPGMPVAPPAQSFLVDTSIPDSS-----PSLQYSFNPPAMPQQTNIPTSNVPYLPQSQVVTTPISLPGMPPITVSASLPQTSNFF 418          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|954577340|ref|XP_014613128.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Polistes canadensis] >gi|954577342|ref|XP_014613129.1| PREDICTED: Golgi reassembly-stacking protein 2 [Polistes canadensis])

HSP 1 Score: 418.3 bits (1074), Expect = 4.200e-113
Identity = 235/425 (55.29%), Postives = 275/425 (64.71%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVNPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFSQPASNYPHVGGVT----SGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHN--PQQNYD-PSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFYS 419
            MGSSHSVEIPGGGTEGYHVLRVQ++SPGQKAGLEAFFDFIVSI N RLDQDN  LK++LKA V KE+T+TVY+SKTQSVR TVI PSMTWGG G LGVS+RFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIG+DS LHESEDL++LIEAHESR LKLYVYNT++D+CREVTITPN+TWGGEGSLGCGIGYGYLHRIP+R+I ET  + +  +  + V   V                                                                     ++PA AGA TTTNPT H    P+SN P V   +    S Y+D+P+               E +VP+G   T +    Q+Y+ P  P+ I  +  +   E  +VTTPI LPGMPPITV+A+LPQ  +FYS
Sbjct:    1 MGSSHSVEIPGGGTEGYHVLRVQDDSPGQKAGLEAFFDFIVSIGNNRLDQDNHLLKDLLKANVDKEVTITVYSSKTQSVRHTVIVPSMTWGGQGFLGVSVRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGADSVLHESEDLFTLIEAHESRPLKLYVYNTKDDSCREVTITPNTTWGGEGSLGCGIGYGYLHRIPIRNIPETKPRNSSYYTTSNVKTTVPNQMQTNATTTVTSIPPGFSIPSNYITTVDNTSKNETVVTSQA------------------ILHPNLSQINPADAGA-TTTNPTIH----PSSNQPIVTTSSSTDISHYKDSPNIPGMPTSPPISSYSMEGNVPIGVTTTPHAITMQSYNLPGAPNTISSL-PFNVKESQLVTTPISLPGMPPITVNATLPQNPSFYS 401          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|350418087|ref|XP_003491728.1| (Golgi reassembly-stacking protein 2 [Bombus impatiens])

HSP 1 Score: 414.1 bits (1063), Expect = 7.900e-112
Identity = 239/430 (55.58%), Postives = 284/430 (66.05%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLV-----NPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLF------SQPASNYPHVGGVTSGYQDT-PSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFYS 419
            MGSSHS+EIPGGGTEGYHVLRVQE SPGQKAGLEAFFDFIVSI NTRLDQDNDTLKE+LK GV K+LT+TVY+SKTQSVRQTVI PS+TWGG GLLGVS+RFCSFEG+NENVWH+LEVHPSSPAELAGLRPFTDYIIG+DS LHESED+++LIEAHESR LKLY+YNT++D+CREVTITPN TWGGEGSLGCGIGYGYLHRIP+R+I E  +  ++   V     NPV + ++ +                                                                P L+PA  G STTTN   H+       +   +N P    + S +Q+T P+  XXXXXXXXXXX    +V   S       +++      + P +   +P +  +VTTPI LPGMPPITVSASLPQ ++FYS
Sbjct:    1 MGSSHSIEIPGGGTEGYHVLRVQEGSPGQKAGLEAFFDFIVSIGNTRLDQDNDTLKELLKNGVDKKLTLTVYSSKTQSVRQTVIVPSLTWGGQGLLGVSVRFCSFEGSNENVWHILEVHPSSPAELAGLRPFTDYIIGADSVLHESEDIFTLIEAHESRPLKLYIYNTQDDSCREVTITPNHTWGGEGSLGCGIGYGYLHRIPIRNIQEHKSNNSYTSHVKATNPNPVTSSITHT------------EGSNVIINIPPGFSIPPNYMSAQENVTKSEVETTSTTMVQNIYTSSVQTYTMPQLNPAAIGGSTTTNSVSHVMPNQTVVNTTCNNDPI---MPSSHQNTMPNIPXXXXXXXXXXXTTNATVLSESTGVVGTPKDFTTVQSDISPPVQFNVP-QSHVVTTPISLPGMPPITVSASLPQNSSFYS 414          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|755937754|ref|XP_011297201.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Fopius arisanus] >gi|755937758|ref|XP_011297202.1| PREDICTED: Golgi reassembly-stacking protein 2 [Fopius arisanus])

HSP 1 Score: 412.9 bits (1060), Expect = 1.800e-111
Identity = 278/434 (64.06%), Postives = 308/434 (70.97%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVN--PVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT-------GXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTT--NPTGHLFSQPASNYPHVGGVTSGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPS------EPSIVTTPIELPGMPPITVSASLPQTAAFY 418
            MGSS S+EIPGGGTEGYHVLRVQE SPGQ+AGLEAFFDFIVSI NTRLDQDNDTLKE+LK  V KEL +TVYNSKTQS+RQT I PSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGL+PFTDYIIG+DSALHESEDL++LIEAHESR LKLYVYNT +D+CREVTITPN+ WGGEGSLGCGIGYGYLHRIP+RS+ E        HL    PVAAQ  P+    XXXXXXXXXXXXXXXXXXXXXXXX           T             XXXXXXXXXXXXXXXXXX    P + GASTTT     GH F+Q +++YP V  +T                                   +PQ+ + P +P V PG T  +P        P +VTTP+ LPGMPP+TVSASLPQ+  FY
Sbjct:    1 MGSSQSLEIPGGGTEGYHVLRVQEGSPGQQAGLEAFFDFIVSIGNTRLDQDNDTLKELLKTNVDKELLVTVYNSKTQSIRQTTIIPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLKPFTDYIIGADSALHESEDLFTLIEAHESRPLKLYVYNTTDDSCREVTITPNTRWGGEGSLGCGIGYGYLHRIPVRSVPEAKPIHNHSHLQPKIPVAAQPPPAQYTVXXXXXXXXXXXXXXXXXXXXXXXXNYTPGLPLDSQTPPTNPISSYPSAPXXXXXXXXXXXXXXXXXXXXXXPKLIGASTTTVMASPGHYFAQ-SNSYPSVEQMT-----------------------------------DPQEPFIPGMPPVAPGQT--IPPMISPLVTPQVVTTPLNLPGMPPLTVSASLPQSPPFY 396          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|998519787|ref|XP_015520844.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Neodiprion lecontei])

HSP 1 Score: 411.0 bits (1055), Expect = 6.700e-111
Identity = 233/428 (54.44%), Postives = 266/428 (62.15%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPH-----LVNPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTT-TNPTGHLFS-QPASNYPHVGGVTSGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTS----YMPSEPSIVTTPIELPGMPPITVSASLPQTAAFY 418
            MGSS SVEIPGGGTEGYHVLRVQ+ SPGQKAGLEAFFDFIV+I NTRLDQDNDTLKE+LKAGV KEL +TVY+SKTQSVRQ+VI PSMTWGG GLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGL+ FTDYII +DS LHESED+++LIEAHESR LKLYVYNT ED+CREVT+TPN+TWGGEGSLGCG+GYGYLHRIP+R+I   S  TA  H     +  PV    S +                                                                P +DP  AGA+TT    T HLF+ Q   N        + Y  TP+                +  P G  +   P  NY     +++ G TS    Y  S+P +VTTPI LPGMPPITVSA+LPQ   +Y
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQDGSPGQKAGLEAFFDFIVAIGNTRLDQDNDTLKELLKAGVDKELQITVYSSKTQSVRQSVIVPSMTWGGQGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLKSFTDYIISADSVLHESEDIFTLIEAHESRPLKLYVYNTNEDSCREVTVTPNNTWGGEGSLGCGLGYGYLHRIPIRNIPSPSV-TASSHSYASNIKTPVTTTASTNVHISQSNPVTNIPPGFSIPPSYVTSNAAMAPPSAIK-----ETVEPTTVSVTPVSPTLPQLDNVPQIDPVSAGATTTXATSTSHLFAGQSDVNLTQSSVQAAEYYGTPNIPGMPLTPPTPASMVNVGPPSGIPMYSTPLPNY-----NLLSGPTSAALPYNVSQPHMVTTPISLPGMPPITVSATLPQNHPYY 417          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|340715773|ref|XP_003396383.1| (Golgi reassembly-stacking protein 2 [Bombus terrestris])

HSP 1 Score: 410.2 bits (1053), Expect = 1.100e-110
Identity = 233/429 (54.31%), Postives = 286/429 (66.67%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLV-----NPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFSQ------PASNYPHVGGVTSGYQDT-PSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFY 418
            MGSSHS++IPGGGTEGYH+LRVQE SPGQKAGLEAFFDFIVSI +TRL+QDNDTLKE+L+ GV K+LT+TVY+SKTQSVRQTVI PS+TWGG GLLGVS+RFCSFEG+NENVWHVLEVHPSSPAELAGLRPFTDYIIG+DS LHESED+++LIEAHESR LK+Y+YNTE+D+CREVTITPN TWGGEGSLGCGIGYGYLHRIP+R+I E  +   +   V     NPV + ++ +                                                                P L+PA  G STTTN   H+ +         +N P    ++S +Q+T P+  XXXXXXXXXXX    +V   ++     ++++      + P +   +P +P +VTTPI LPGMPPITVSAS+PQ ++FY
Sbjct:    1 MGSSHSIQIPGGGTEGYHILRVQEGSPGQKAGLEAFFDFIVSIGDTRLNQDNDTLKELLRNGVDKKLTLTVYSSKTQSVRQTVIVPSLTWGGQGLLGVSVRFCSFEGSNENVWHVLEVHPSSPAELAGLRPFTDYIIGADSVLHESEDIFTLIEAHESRPLKMYIYNTEDDSCREVTITPNHTWGGEGSLGCGIGYGYLHRIPIRNIQEHKSNNLYTSHVKATNPNPVTSSITQT------------EESNVIINVPPGFSIPPNYMSAQENVTKSEVETTSTTTVQNIYTSSVQTYTMPQLNPATIGGSTTTNSVSHVMANQTVVNTTCNNDPI---MSSSHQNTMPNIPXXXXXXXXXXXTTNATVLSKAIGVVGTRKDFTTVQSDISPPVQFNVP-QPHVVTTPISLPGMPPITVSASMPQNSSFY 413          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|987901454|ref|XP_015437819.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Dufourea novaeangliae] >gi|1016157815|gb|KZC04977.1| Golgi reassembly-stacking protein 2 [Dufourea novaeangliae])

HSP 1 Score: 408.3 bits (1048), Expect = 4.300e-110
Identity = 240/426 (56.34%), Postives = 279/426 (65.49%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVNP-VAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFSQPASNYPHVGGVTSGYQDT-------PSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFYS 419
            MGSSHS+EIPGGGTEGYHVLRVQ+ SPGQKAGLEAFFDFIV+I NTRL+QDNDTLKE+LK GV K+LT+TVY+SKTQ+VRQT+I PS+TWGG GLLGVS+RFCSFEG+NENVWHVLEVHPSSPAELAGLRPFTDYIIG+DS LHESEDL++LIEAHESR+L LYVYNTE+D+CREVTI PN TWGGEGSLGCGIGYGYLHRIP+RS+ E  + T++   V P V +QV+                                         T                        P L+PA  G STT +   H+ S   +    +G   S   +T         XXXXXXXXXXXXX  E    +G     +  Q     +PS  P M  +  S+  +VTTPI LPGMPPITVSASLPQ   FY+
Sbjct:    1 MGSSHSIEIPGGGTEGYHVLRVQDGSPGQKAGLEAFFDFIVAIGNTRLNQDNDTLKELLKGGVDKKLTLTVYSSKTQAVRQTIIVPSLTWGGQGLLGVSVRFCSFEGSNENVWHVLEVHPSSPAELAGLRPFTDYIIGADSILHESEDLFTLIEAHESRSLNLYVYNTEDDSCREVTIIPNHTWGGEGSLGCGIGYGYLHRIPIRSVQEHKSNTSYTSNVKPSVPSQVTTGTVTRTGGNNMVISIPPGFSIPPNYVPSQDITTKADLETTT---------IAQTVYTPSAQTYTIPQLNPATVGGSTTIS-IPHMVSNQGTASVMIGNNASPQPNTMXXXXXXXXXXXXXXXXXXXXXLNEACATVGLPKDFSAVQGVSQGVPS--PEM-QFNASQSHVVTTPISLPGMPPITVSASLPQNTPFYA 413          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|1061137503|ref|XP_017892314.1| (Golgi reassembly-stacking protein 2 [Ceratina calcarata])

HSP 1 Score: 406.8 bits (1044), Expect = 1.300e-109
Identity = 268/436 (61.47%), Postives = 310/436 (71.10%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVNPVAAQVSPS--------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTN------PTGHLFSQPASN----YPHVGGVTSGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFYS 419
            MGSSHS+EIPGGGTEGYHVLRVQE SPGQKAGLEAFFDFIV+I NTRLDQDNDTLKE+LK GV K+L +TVY+SKTQSVRQTV+ PS+TWGG GLLGVS+RFCSFEG+NENVWHVLEVHPSSPAE+AGLRPFTDYIIG+DS LHESE+L+SLIE+HESR+LKLYVYNT++D+CRE+ ITPN  WGGEGSLGCGIGYGYLHRIP+R+I E  +  ++   + P  A   PS           XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX T                        P L+PA  G STTTN      P  ++ +    N    +PH         +T      XXXXXXXXXX  +S+   + V H        ++ S +P    +   +  +VTTPI LPGMPPITVSASLPQ  +FYS
Sbjct:    1 MGSSHSIEIPGGGTEGYHVLRVQEGSPGQKAGLEAFFDFIVAIGNTRLDQDNDTLKELLKNGVDKKLALTVYSSKTQSVRQTVVVPSLTWGGQGLLGVSVRFCSFEGSNENVWHVLEVHPSSPAEVAGLRPFTDYIIGADSPLHESENLFSLIESHESRSLKLYVYNTDDDSCREIMITPNHNWGGEGSLGCGIGYGYLHRIPIRNIQEHKSNNSYMSNIKPTIATTIPSTTPIMIPDPSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTKSELEAVTSMQPPTYAQSSQTYYAPQLNPATIGGSTTTNSIPYTVPNQNVINTSCGNDFGAHPH---------NTMPNIPGXXXXXXXXXXTTISLNETANVQHTGTPKDFTNVQSTVPPPVQFNVPQSHMVTTPISLPGMPPITVSASLPQNTSFYS 427          
BLAST of g70.t1 vs. GenBank_protein
Match: gi|972171912|ref|XP_015183758.1| (PREDICTED: Golgi reassembly-stacking protein 2 [Polistes dominula] >gi|972171914|ref|XP_015183837.1| PREDICTED: Golgi reassembly-stacking protein 2 [Polistes dominula])

HSP 1 Score: 405.2 bits (1040), Expect = 3.700e-109
Identity = 240/425 (56.47%), Postives = 278/425 (65.41%), Query Frame = 0
Query:    1 MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQDNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSIRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLYSLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLHRIPLRSISETSTKTAFPHLVNPVAAQVSPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGXXXXXXXXXXXXXXXXXXXXXXXPVLDPAVAGASTTTNPTGHLFSQPASNYPHVGGVT----SGYQDTPSXXXXXXXXXXXXXXXEMSVPMGSVVTHN--PQQNYD-PSIPSVIPGMTSYMPSEPSIVTTPIELPGMPPITVSASLPQTAAFYS 419
            MGSSHSVEIPGGGTEGYHVLRVQ++SPGQKAGLEAFFDFIVSI NTRLDQDN  LK++LKA V KE+T+TVY+SKTQSVR TVI PSMTWGG G LGVS+RFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIG+DS LHESEDL++LIEAHESR LKLYVYNT++D+CREVTITPN+TWGGEGSLGCGIGYGYLHRIP+R+   T+      +          P+                                                                   +PA    +TTTNPT H    P+SN P V   +    S Y+D+P+  XXXXXXXXXXXXX     +G   T +    Q+Y+ P  P+ I  +  +   E  +VTTPI LPGMPPITV+A+LPQ  +FYS
Sbjct:    1 MGSSHSVEIPGGGTEGYHVLRVQDDSPGQKAGLEAFFDFIVSIGNTRLDQDNHLLKDLLKANVDKEVTITVYSSKTQSVRHTVIVPSMTWGGQGFLGVSVRFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGADSVLHESEDLFTLIEAHESRPLKLYVYNTKDDSCREVTITPNNTWGGEGSLGCGIGYGYLHRIPIRNTPGTTKPRNSSYYPTSNVKTTVPNQMQTNATTPVTSIPPGFSIPPNYITSVDNTSKNETVVTSQAILHPNLSQ-----------------TNPAADTGATTTNPTIH----PSSNQPIVTSTSSTDISHYKDSPNIPXXXXXXXXXXXXXXXXXXIGLTTTPHAITMQSYNLPGAPNTISSL-PFNVKESQLVTTPISLPGMPPITVNATLPQNPSFYS 403          
The following BLAST results are available for this feature:
BLAST of g70.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1000745824|ref|XP_015595663.1|3.700e-11761.72Golgi reassembly-stacking protein 2 [Cephus cinctu... [more]
gi|665800206|ref|XP_008548056.1|3.200e-11359.63PREDICTED: Golgi reassembly-stacking protein 2 [Mi... [more]
gi|954577340|ref|XP_014613128.1|4.200e-11355.29PREDICTED: Golgi reassembly-stacking protein 2 [Po... [more]
gi|350418087|ref|XP_003491728.1|7.900e-11255.58Golgi reassembly-stacking protein 2 [Bombus impati... [more]
gi|755937754|ref|XP_011297201.1|1.800e-11164.06PREDICTED: Golgi reassembly-stacking protein 2 [Fo... [more]
gi|998519787|ref|XP_015520844.1|6.700e-11154.44PREDICTED: Golgi reassembly-stacking protein 2 [Ne... [more]
gi|340715773|ref|XP_003396383.1|1.100e-11054.31Golgi reassembly-stacking protein 2 [Bombus terres... [more]
gi|987901454|ref|XP_015437819.1|4.300e-11056.34PREDICTED: Golgi reassembly-stacking protein 2 [Du... [more]
gi|1061137503|ref|XP_017892314.1|1.300e-10961.47Golgi reassembly-stacking protein 2 [Ceratina calc... [more]
gi|972171912|ref|XP_015183758.1|3.700e-10956.47PREDICTED: Golgi reassembly-stacking protein 2 [Po... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 420..457
NoneNo IPR availableGENE3D2.30.42.10coord: 111..208
e-value: 1.5E-37
score: 129.9
NoneNo IPR availableGENE3D2.30.42.10coord: 1..110
e-value: 3.7E-39
score: 135.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..476
NoneNo IPR availablePROSITEPS51865PDZ_GRASPcoord: 111..199
score: 34.1
NoneNo IPR availablePROSITEPS51865PDZ_GRASPcoord: 15..105
score: 31.365
NoneNo IPR availableCDDcd00987PDZ_serine_proteasecoord: 19..79
e-value: 4.07192E-8
score: 48.4048
IPR024958GRASP55/65 PDZ-like domainPFAMPF04495GRASP55_65coord: 88..204
e-value: 3.6E-48
score: 163.4
IPR007583GRASP55/65PANTHERPTHR12893GOLGI REASSEMBLY STACKING PROTEIN GRASPcoord: 1..456
IPR036034PDZ superfamilySUPERFAMILY50156PDZ domain-likecoord: 12..77
IPR036034PDZ superfamilySUPERFAMILY50156PDZ domain-likecoord: 93..181

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:534295..536999 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g70.t1g70.t1Venturia canescensmRNAscaffold_1 534295..536999 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g70.t1-PA ID=g70.t1-PA|Name=g70.t1|organism=Venturia canescens|type=polypeptide|length=476bp
MGSSHSVEIPGGGTEGYHVLRVQENSPGQKAGLEAFFDFIVSINNTRLDQ
DNDTLKEILKAGVGKELTMTVYNSKTQSVRQTVIEPSMTWGGHGLLGVSI
RFCSFEGANENVWHVLEVHPSSPAELAGLRPFTDYIIGSDSALHESEDLY
SLIEAHESRALKLYVYNTEEDTCREVTITPNSTWGGEGSLGCGIGYGYLH
RIPLRSISETSTKTAFPHLVNPVAAQVSPSAYTSPIIVNPPTSVPPGFTI
PQNYTPTTAPSDTDKPREGTGSSTSVAMTPVIPTVPTIPTSSVYPVLDPA
VAGASTTTNPTGHLFSQPASNYPHVGGVTSGYQDTPSIPGMPTVPPLPPL
PAEMSVPMGSVVTHNPQQNYDPSIPSVIPGMTSYMPSEPSIVTTPIELPG
MPPITVSASLPQTAAFYSPMLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQHQSPPSTVTNPLSAQTSAQ
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR024958GRASP55/65_PDZ
IPR007583GRASP55_65
IPR036034PDZ_sf
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding