g71.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg71.t1
Unique Nameg71.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length144
Homology
BLAST of g71.t1 vs. GenBank_protein
Match: gi|755937761|ref|XP_011297203.1| (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Fopius arisanus])

HSP 1 Score: 134.8 bits (338), Expect = 2.800e-28
Identity = 72/150 (48.00%), Postives = 95/150 (63.33%), Query Frame = 0
Query:    1 MAALMRLGAVRSLANSFARSAFKG--RRNINTSS----GKKTVEAAGDTCAPSKKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            MA LMRLGA + L      S+ K   +R+INTSS       T  A  D   P +  NW+++G+S  D  LDR   H++ F ++SLCL+ GG  L + PDP +REWAQRE YL+LR RE  GLP +   Y+DP K+ +P+DEELGDT+III
Sbjct:    1 MANLMRLGAAKFLRGLTRASSPKELVKRSINTSSKPPQASHTPAATCDEPLPQQSNNWISWGFSEDDETLDRFGAHLTFFTSVSLCLILGGTILAYTPDPKLREWAQREGYLQLRYREENGLPLISRNYIDPSKIYIPSDEELGDTEIII 150          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|970898432|ref|XP_015114825.1| (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Diachasma alloeum])

HSP 1 Score: 129.4 bits (324), Expect = 1.200e-26
Identity = 72/155 (46.45%), Postives = 102/155 (65.81%), Query Frame = 0
Query:    1 MAALMRLGAVRSLANSFARSAFKG----RRNINTSSGKKTVEAAGDTCAPS-------KKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            M++L+RLGA  +L    AR   +     +R INTSS  K  +A+  T A +       + KNWV++G+S  +  +DR+A H++ F  +S+CLV GG  + +APDP +REW+QREAYL+LR +E  GLP +   YVDP K+ LP+DEELGDT+III
Sbjct:    1 MSSLIRLGAASALKRGLARPLQRPKQLVKRPINTSS--KPPQASHSTPATTVGEAPVEQSKNWVSWGFSEENEYIDRLAAHMTFFTTVSICLVLGGTLIAYAPDPKLREWSQREAYLQLRYKEEHGLPPISRNYVDPAKLYLPSDEELGDTEIII 153          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|1572831750|gb|RZB39925.1| (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, partial [Asbolus verrucosus])

HSP 1 Score: 128.3 bits (321), Expect = 2.600e-26
Identity = 64/123 (52.03%), Postives = 81/123 (65.85%), Query Frame = 0
Query:   25 RRNINTSSGKKTVEAAGDTCAPSKK---KNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            RR ++TS        A      +KK   KNWV YG+ T     DR A+H   F +++LCLV GG Y+ + PD  +R+W+QREA+LELRRRE LGLP VDP  +DP KV LP+DEELGDT+III
Sbjct:  133 RRLVSTSKKSNDTAVADAIKTETKKVEHKNWVNYGFDTKSKDADRTALHSIMFASVTLCLVVGGYYITYLPDYNLRDWSQREAFLELRRREKLGLPLVDPNLIDPAKVTLPSDEELGDTEIII 255          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|91090522|ref|XP_970004.1| (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Tribolium castaneum])

HSP 1 Score: 127.5 bits (319), Expect = 4.500e-26
Identity = 64/123 (52.03%), Postives = 87/123 (70.73%), Query Frame = 0
Query:   25 RRNINTSSGKKTVEAAGDTCAPSKK---KNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            RR ++TS  KKT E A      ++K   KNWV+YG+       DR AMH   F +++LCLV GG ++++APD  +++W+QREA+LELRRRE +GLP VDP  +DP K+ LP+DEELGDT+III
Sbjct:   20 RRLVSTS--KKTNETAVADAVKTEKVEHKNWVSYGFDAKGKESDRTAMHSIMFASVTLCLVCGGYFMMYAPDYNLKDWSQREAFLELRRREKMGLPLVDPNLIDPAKIQLPSDEELGDTEIII 140          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|1080063927|ref|XP_018574069.1| (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Anoplophora glabripennis])

HSP 1 Score: 125.6 bits (314), Expect = 1.700e-25
Identity = 66/124 (53.23%), Postives = 86/124 (69.35%), Query Frame = 0
Query:   25 RRNINTSSGKKTVEAAGDTC-APSK---KKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            RR ++TS+ K    A  D C  PSK   +KNW++YG+  T    DR A+H   F +I+LCLV GG +L + PD   R+WAQREA+LELRRRE  GLP ++P +VDP K+ LP+DEELGDT+III
Sbjct:   21 RRFVSTSN-KNNETATVDVCNTPSKTTAEKNWISYGFDYTTKAGDRNALHSIMFGSITLCLVVGGFFLAYMPDYNNRDWAQREAFLELRRREQNGLPLINPNFVDPSKIPLPSDEELGDTEIII 143          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|1279745732|ref|XP_022917916.1| (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Onthophagus taurus])

HSP 1 Score: 125.6 bits (314), Expect = 1.700e-25
Identity = 69/143 (48.25%), Postives = 89/143 (62.24%), Query Frame = 0
Query:    7 LGAVRSLANSFARSAFK--GRRNINTS---SGKKTVEAAGDTCAPSKKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            + AV  L NS  R       +R I+TS   S   TV+A   +      KNWV+YG+   D   DR  MH + F +++LCLV GG +  + PD  +R+W+QREA+LELRRRE LGLP VD   VDP K+ LP+DEELGDT+III
Sbjct:    1 MAAVIRLQNSIVRRVLPTINKRCISTSKKNSDTATVDAESKSTTSVTTKNWVSYGFDRKDEAEDRRGMHSTFFFSVTLCLVFGGFFWAYTPDYNLRDWSQREAFLELRRREKLGLPLVDANLVDPKKIQLPSDEELGDTEIII 143          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|766922784|ref|XP_011505982.1| (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Ceratosolen solmsi marchali])

HSP 1 Score: 124.8 bits (312), Expect = 2.900e-25
Identity = 60/110 (54.55%), Postives = 76/110 (69.09%), Query Frame = 0
Query:   35 KTVEAAGDTCAPSKKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            KT     D  +   +KNWV+YG+S     LD+  MH S F+ IS+CL  GG  LI+ PD  M++WAQREAYLELRRRE  GLP +DP  +DP K +LP+DEELGD++III
Sbjct:   43 KTFSNHMDKVSDGNRKNWVSYGFSEESEKLDKQIMHFSFFITISICLTLGGYILIYLPDFKMKDWAQREAYLELRRRENGGLPPIDPNLIDPSKFLLPSDEELGDSEIII 152          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|998519777|ref|XP_015520839.1| (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Neodiprion lecontei])

HSP 1 Score: 124.0 bits (310), Expect = 4.900e-25
Identity = 69/145 (47.59%), Postives = 94/145 (64.83%), Query Frame = 0
Query:    1 MAALMRLGAVRSLANSFARSAFKGRRNINTSSGKKTVEAAGDT-CAPSKKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            MA ++RL  ++ L N  A +    RR+IN+SS  K  EA   T CA   K+NWV+YG+      +DR  M  + F+ ++LCLV GG    + PDP +++WAQREAYL LR RE  GLP +D  ++DP K+ LP+DEELGDT+III
Sbjct:    1 MAGVVRLQGLQRLRN--ALTGVTSRRSINSSS--KKCEAKSQTQCAEPPKENWVSYGFDRNSKTIDRNVMKQTLFVTVTLCLVIGGFGWSYLPDPLLKDWAQREAYLLLRYREENGLPLIDRNFIDPAKIKLPSDEELGDTEIII 141          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|270014371|gb|EFA10819.1| (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial-like Protein, partial [Tribolium castaneum])

HSP 1 Score: 123.2 bits (308), Expect = 8.400e-25
Identity = 54/95 (56.84%), Postives = 73/95 (76.84%), Query Frame = 0
Query:   50 KNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            KNWV+YG+       DR AMH   F +++LCLV GG ++++APD  +++W+QREA+LELRRRE +GLP VDP  +DP K+ LP+DEELGDT+III
Sbjct:    5 KNWVSYGFDAKGKESDRTAMHSIMFASVTLCLVCGGYFMMYAPDYNLKDWSQREAFLELRRREKMGLPLVDPNLIDPAKIQLPSDEELGDTEIII 99          
BLAST of g71.t1 vs. GenBank_protein
Match: gi|817059732|ref|XP_012251384.1| (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Athalia rosae] >gi|1183212831|ref|XP_020706567.1| NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial [Athalia rosae])

HSP 1 Score: 123.2 bits (308), Expect = 8.400e-25
Identity = 68/144 (47.22%), Postives = 93/144 (64.58%), Query Frame = 0
Query:    1 MAALMRLGAVRSLANSFARSAFKGRRNINTSSGKKTVEAAGDTCAPSKKKNWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWAQREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII 145
            MAA++RL +++ L    A ++   RR IN+SS K   +    + AP  K NWV+YG+   D  +DR     + FM I++ +V GG  L + PDP +R+W QREAYLE+RRRE LGLP +D   V+P  +VLPTDEEL DT+III
Sbjct:    1 MAAVVRLQSLQGLRK--ASTSVISRRTINSSSKKCESKIPEISFAPPPKTNWVSYGFDYKDKTIDRNVTKNTLFMTITVMMVFGGFLLSYLPDPQLRDWTQREAYLEIRRREELGLPHIDCNLVNPANIVLPTDEELADTEIII 142          
The following BLAST results are available for this feature:
BLAST of g71.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|755937761|ref|XP_011297203.1|2.800e-2848.00PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta ... [more]
gi|970898432|ref|XP_015114825.1|1.200e-2646.45PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta ... [more]
gi|1572831750|gb|RZB39925.1|2.600e-2652.03NADH dehydrogenase [ubiquinone] 1 beta subcomplex ... [more]
gi|91090522|ref|XP_970004.1|4.500e-2652.03PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta ... [more]
gi|1080063927|ref|XP_018574069.1|1.700e-2553.23NADH dehydrogenase [ubiquinone] 1 beta subcomplex ... [more]
gi|1279745732|ref|XP_022917916.1|1.700e-2548.25NADH dehydrogenase [ubiquinone] 1 beta subcomplex ... [more]
gi|766922784|ref|XP_011505982.1|2.900e-2554.55PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta ... [more]
gi|998519777|ref|XP_015520839.1|4.900e-2547.59PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta ... [more]
gi|270014371|gb|EFA10819.1|8.400e-2556.84NADH dehydrogenase [ubiquinone] 1 beta subcomplex ... [more]
gi|817059732|ref|XP_012251384.1|8.400e-2547.22NADH dehydrogenase [ubiquinone] 1 beta subcomplex ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019329NADH:ubiquinone oxidoreductase, ESSS subunitPFAMPF10183ESSScoord: 39..120
e-value: 7.6E-25
score: 87.2
IPR019329NADH:ubiquinone oxidoreductase, ESSS subunitPANTHERPTHR13327NADH-UBIQUINONE OXIDOREDUCTASE ESSS SUBUNIT, MITOCHONDRIAL PRECURSORcoord: 14..142
NoneNo IPR availablePANTHERPTHR13327:SF0NADH DEHYDROGENASE [UBIQUINONE] 1 BETA SUBCOMPLEX SUBUNIT 11, MITOCHONDRIALcoord: 14..142
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..66
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 67..90
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 91..144
NoneNo IPR availableSIGNALP_GRAM_POSITIVESignalP-TMSignalP-TMcoord: 1..18
score: 0.489
NoneNo IPR availableTMHMMTMhelixcoord: 67..89

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:538283..538717 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g71.t1g71.t1Venturia canescensmRNAscaffold_1 538283..538717 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g71.t1-PA ID=g71.t1-PA|Name=g71.t1|organism=Venturia canescens|type=polypeptide|length=144bp
MAALMRLGAVRSLANSFARSAFKGRRNINTSSGKKTVEAAGDTCAPSKKK
NWVTYGYSTTDPVLDRIAMHVSSFMAISLCLVTGGIYLIFAPDPGMREWA
QREAYLELRRREALGLPAVDPFYVDPDKVVLPTDEELGDTDIII
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR019329NADH_UbQ_OxRdtase_ESSS_su