g72.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg72.t1
Unique Nameg72.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length2649
Homology
BLAST of g72.t1 vs. GenBank_protein
Match: gi|1000717785|ref|XP_015595612.1| (eIF-2-alpha kinase activator GCN1 isoform X1 [Cephus cinctus])

HSP 1 Score: 4213.7 bits (10927), Expect = 0.000e+0
Identity = 2226/2650 (84.00%), Postives = 2434/2650 (91.85%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MADAEL++ALKDLPNRIQTA K ERREI +NV++VLSNP IN+KI+GGICK+ SITLHRYKDTASQSYVK LIVA++K+  E  IKH++  ITEQAVWHKNVVPT NTAL+AYL LKWS L+V+HG +  S+    ELPK+IEAQ NLSAAA+AS +KKL++KVY+L +H+WK+    +E+Y++VL  LEASNGVIVLASL T+YL+   K+ L D  K  ++++ IKV+ISCKKKP+LYVV+AA   L+R++H++FK+ LLPALQK+MLRNPEIII+SVG ILSG+SLDLS+YS++ISKGLFANLHSKED VR+ AA+ACRRLALQCSD+ ALE LL+SLFAVFHGSEGKLT+ THKISVLQGAGNLS N  SGS +Q + E AC HFIKVLETEVHEKTLIHALEMM+LWC KF N +PKSVI+ FKKGMAAK+STAGVRTAYIKL+    + SHSA ++PIL+QAITRA  Q+AQP  VTEGL+A +LLLKLV+AG+VENDKQ++LWNA+D+Q+FF EKFLSTC DDILY LM  CE+L+ E++DRLNEKAL G++RAIVACVTAPKSS RR+CAP+ KK+LTGL +YE  +ALLLEFNKFLE A+I  + ++E+K+E   SGEV+GRSLADGL+A+CSGSFLFE P++++  D+LIPAHHP I +AVPNLW KI +NF L P+DFL     ++K +F++NY+  PSYENAL +++SL PD++L +L++NVT KLDDPEILRVTKDEYFTYLTP+GELYDKSVIPGNDENDILN+MNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEEALK+Q A+E+ IRKRL E  +KIT AVSM+ AA  G+ F    +LKDLL PILK+L SPLAAPTM QLYI L K V+I+ + T+S L+AHVTLRQL+PQCDL+ AW+EE L++AV RTL L+H YT+RQK L  AP FCYIF F+ KTLL+ KD+ +I++GLQIVQEHAKQRG  +  +D RHP+LLPRKQMFDLLIELMS+T GR+QS AVAT LDVA+SGSG  +CA A+G++IDSL GALQN+LPAVRDAALR LMI++LAFPSEKEDY QLLRLTRR+W+AKFD  +ENK LA+ELW A+G  A+P+ILCEELIQD+AHPVE +QQAAA A+AQLL   P+LMP ILD LLELYQ+KLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETI+RLV+FFVSTGLGDRN +VRTEML AAVAAVD HGKANITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMG LARHLEKDDPRIKPIV+RLI+ALSTPSQQVQEAVANCLPHLVPSIK+DAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTP+TLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQS QADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVMAIKSRVVLPYLVPQLTS PVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNE QELEYCQAVILS+TDEVGVRTVMDQLM+AT+A+D SRRRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTD+DK+VLQ SWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKG ELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVI+LTSA ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELH GIKT+DD  IRETMLQALRGVLTPAGDKMTEPMRKQVF TLS+MLG+ +DVTR AVAGCYGALLRWL+PEQLA AFN+NLLCND NADWMLRHGRSAALFVVLKESP T+Y   E+ER CKVILSYLAADRVQIAMNGVRACGYLFQYLM +  PIP  ILTPFVRSMN+ +NDVKQLLARVCTH+ARNIP  KMSPELLKAL+PMLVNGTKEKNGYVKANSELALIAVLRLK GDEE QRC+ALLDVGA+ESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADAELSKALKDLPNRIQTASKNERREILQNVVDVLSNPGINEKIVGGICKVLSITLHRYKDTASQSYVKYLIVALLKEQREATIKHMSNAITEQAVWHKNVVPTYNTALTAYLTLKWSVLVVRHGINNGSKESWLELPKLIEAQTNLSAAALASAEKKLSEKVYTLFTHEWKLVPAIEEKYIEVLMKLEASNGVIVLASLLTRYLVETKKDDLIDKLKPSMIEALIKVSISCKKKPELYVVDAAASLLKRVSHEEFKNLLLPALQKAMLRNPEIIIESVGRILSGMSLDLSQYSQDISKGLFANLHSKEDLVRDEAADACRRLALQCSDSTALENLLSSLFAVFHGSEGKLTVATHKISVLQGAGNLSYNVVSGSNIQKLTETACSHFIKVLETEVHEKTLIHALEMMSLWCKKFANDIPKSVIDAFKKGMAAKTSTAGVRTAYIKLLSWTPITSHSAMIAPILTQAITRATTQSAQPAAVTEGLLATYLLLKLVLAGQVENDKQSILWNAVDDQLFFSEKFLSTCGDDILYYLMLLCERLVTEFSDRLNEKALGGIYRAIVACVTAPKSSIRRKCAPVLKKMLTGLNSYELVEALLLEFNKFLETAKIRVDSEKESKEE-TSSGEVSGRSLADGLMAICSGSFLFEVPSMQITRDALIPAHHPTIFRAVPNLWFKIARNFGLVPKDFLRTFGSEIKKLFLNNYKPVPSYENALASVISLAPDVILPSLISNVTGKLDDPEILRVTKDEYFTYLTPEGELYDKSVIPGNDENDILNAMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEEALKAQTAKESGIRKRLAELNAKITDAVSMINAAARGNSFELGLHLKDLLHPILKDLGSPLAAPTMLQLYISLRKTVKISNNNTLSDLIAHVTLRQLQPQCDLDQAWEEEPLDEAVKRTLALIHTYTIRQKVLFTAPTFCYIFAFIKKTLLSCKDDGMITQGLQIVQEHAKQRGDISISKDARHPKLLPRKQMFDLLIELMSTTTGRVQSQAVATLLDVAQSGSGLPNCALATGEDIDSLTGALQNSLPAVRDAALRGLMIIRLAFPSEKEDYNQLLRLTRRIWVAKFDICEENKHLAEELWTAAGLVANPDILCEELIQDIAHPVEPIQQAAACALAQLLTDDPQLMPAILDRLLELYQDKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETIHRLVQFFVSTGLGDRNHAVRTEMLTAAVAAVDLHGKANITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGLLARHLEKDDPRIKPIVLRLISALSTPSQQVQEAVANCLPHLVPSIKDDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRTATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPKTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSEQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMAIKSRVVLPYLVPQLTSPPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEVQELEYCQAVILSVTDEVGVRTVMDQLMEATRAEDASRRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDDDKDVLQMSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGHELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIRLTSAAALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHIGIKTADDPTIRETMLQALRGVLTPAGDKMTEPMRKQVFATLSNMLGYSEDVTRNAVAGCYGALLRWLTPEQLAAAFNDNLLCNDVNADWMLRHGRSAALFVVLKESPGTVYTGKEKERVCKVILSYLAADRVQIAMNGVRACGYLFQYLMNDGQPIPQQILTPFVRSMNHTNNDVKQLLARVCTHLARNIPSEKMSPELLKALLPMLVNGTKEKNGYVKANSELALIAVLRLKHGDEEHQRCIALLDVGAKESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2649          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|817194901|ref|XP_012272971.1| (eIF-2-alpha kinase activator GCN1 [Orussus abietinus])

HSP 1 Score: 4178.2 bits (10835), Expect = 0.000e+0
Identity = 2212/2650 (83.47%), Postives = 2416/2650 (91.17%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MADAEL++ALKDLPNR+QTA KKERREI +NVI+VLSNP IN+KI+GGICK+ SITLHRYKDTASQSY+K LI+A++K  P+  +KH+   +TEQAVWHKN+VPT +TA +AY ALKWSTL++ +G +K S++ + ELPK+IEAQANLSAAA+AS +KKL DKVYSLL HQW V    +++Y D+L+ +EA NGVIVL SL  K+L++ DK    +  K  IL+SFIKV ISCKKKP+LYVV+AA P LRR++HDDFK  LLPALQK+MLRNPEIII+SVGHILSGL LDLSRYS+EISKGLFANLHSKED VR+ +A+ACRRLALQCSDT+A+E LLA+LFAVFHGSEGKLT+ THKISVLQ AGNLS+N A GS VQ +AEVAC HFIKVLETEVHEKTLIHALEMM LWC KF N+VPK+V+E FKKGMAAK+STAGVRTAYIKL  S  + SHS T++PILSQAITRA QQ  QP  VTEGLVA++LLLKLV+AG VENDKQ+VLW+ IDEQIFF EKFLSTC DD LY+LMQ CEKLI E+ADRLNEKA++GV+RAIV C  APKS+TRRRC PL KK+L+ L TYEPA+ALL+EFNKFL NA+   + ++E KD+  P+ EV GRSLADGLLA+CSGSFLFE P +++  D+LIPAHHP ILKAVPNLW KIVKNF L P++FL +   +V+ + I  Y+  PSYENAL  +VSL PD++L +LV+NVT+KLDDPEIL+VTKDEYFTYLTP+GELYDKSVI  +DEN+ILN+MNMKRESK YSFKEQ EELQLRRELYEKRKREGKIKEPKLT KQEEALK+Q A+ENAIRKRL EF SKI  AVS++ AA  G++   S YLKDLL PILK L SPLAA  M++LY+ L +IV+IT D  + +LVAHVTLRQL+PQCD++A W+EE L+KAV R LNL+H +TV+QKQL  APAFCY+FPF+ KTL+T KD+S+I++GLQ++Q+HAKQR   +D  D RHPRLLPRKQMFDLLIELM++TAGR+QSHAVAT LDVA SGSG A  A A+ DEIDSL GALQN+LPAVRDAALR L ++  AFPSEKEDY+QLLRLTRR+WIAKFD  +ENK +A +LW+++G  A+ EILC+ELI D+AHPVE +QQAAA A+AQLL   P+LMP ILD LL+LY +KL MIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLT +TI +LV+FFVSTGLGDRN +VRTEML AAVAAVD HGKANITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLV SIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLC MLGRLFEPYIVHVLPHLLLCFGDS+QYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTS+DKRQVAARTLGDLVRKLGERVLPEIIPILERGLQS QADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVM IKSRVVLPYLVPQLTS PVNTKALSILASVAG+ALTRFLHKILPALLTALSSAQGT NE QELEYCQAVILS+TDEVGVRTVMDQLMDAT+++DVSRRRSAATLLC FCRDTRADYSQY+PQLLRGL+HLFTD+DK+VLQ SWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAIL GMPEAKEQAAQGLGEVI+LTSA+ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDD AIRETMLQALRGVLTPAGDKMTEPMR+QVF TLS ML +P+DVTR A AGCYGA+L+WL+PEQLA AFN++LLCND NADW+LRHGRSAALFV LKE+P T+Y   E++R CKVILSYLAAD+VQIAMNGVR CGYLFQYLM E  PIP  ILTPFVRSMN++SNDVKQLLARVC H+ARNI   KMSPELLK+L+PMLVNGTKEKNGYVKANSELALIAVLRLKQGDEE QRCMALLDVGA+ESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADAELSKALKDLPNRVQTASKKERREILQNVIDVLSNPGINEKIIGGICKVVSITLHRYKDTASQSYIKNLIIALLKNQPDATVKHMTNAVTEQAVWHKNLVPTYSTAATAYTALKWSTLIILYGINKGSEATQSELPKLIEAQANLSAAAIASGNKKLRDKVYSLLKHQWTVVEGLEDKYADMLTKMEAGNGVIVLTSLLIKHLVATDKCAQVEKLKDGILESFIKVTISCKKKPELYVVDAAVPLLRRVSHDDFKSHLLPALQKAMLRNPEIIIESVGHILSGLMLDLSRYSQEISKGLFANLHSKEDLVRDESADACRRLALQCSDTSAIEDLLAALFAVFHGSEGKLTVATHKISVLQAAGNLSRNGAFGSSVQRLAEVACDHFIKVLETEVHEKTLIHALEMMALWCEKFANEVPKNVVEAFKKGMAAKTSTAGVRTAYIKLFFSAPIASHSNTVAPILSQAITRAAQQCIQPAAVTEGLVASYLLLKLVLAGRVENDKQSVLWSTIDEQIFFSEKFLSTCGDDTLYHLMQLCEKLISEFADRLNEKAMNGVNRAIVYCANAPKSATRRRCFPLIKKVLSDLSTYEPAEALLIEFNKFLNNAKFKADSEKEVKDDS-PANEVCGRSLADGLLAICSGSFLFELPTMQMTRDALIPAHHPVILKAVPNLWLKIVKNFGLTPKEFLRKFGSEVRRVLIQGYKPIPSYENALARVVSLAPDVILPSLVSNVTNKLDDPEILKVTKDEYFTYLTPEGELYDKSVISSSDENEILNAMNMKRESKAYSFKEQLEELQLRRELYEKRKREGKIKEPKLTPKQEEALKAQTAKENAIRKRLTEFNSKIVDAVSLVNAAARGNRTDLSLYLKDLLPPILKGLGSPLAAHIMAELYVSLRQIVKITNDTILGNLVAHVTLRQLQPQCDVDAVWEEEPLDKAVKRALNLIHLHTVKQKQLFSAPAFCYVFPFIKKTLMTCKDDSMITQGLQVIQDHAKQRADNSDPRDLRHPRLLPRKQMFDLLIELMTTTAGRVQSHAVATLLDVAESGSGAAGAAMATNDEIDSLTGALQNSLPAVRDAALRGLTVIHSAFPSEKEDYDQLLRLTRRIWIAKFDVCEENKEMAQKLWDSAGLVANAEILCDELINDIAHPVEPIQQAAACALAQLLTEDPKLMPSILDRLLQLYTDKLVMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTSDTIFKLVQFFVSTGLGDRNPAVRTEMLTAAVAAVDLHGKANITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVSSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCMMLGRLFEPYIVHVLPHLLLCFGDSNQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSFDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSEQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMTIKSRVVLPYLVPQLTSPPVNTKALSILASVAGDALTRFLHKILPALLTALSSAQGTANEVQELEYCQAVILSVTDEVGVRTVMDQLMDATRSEDVSRRRSAATLLCTFCRDTRADYSQYIPQLLRGLIHLFTDDDKDVLQMSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILTGMPEAKEQAAQGLGEVIRLTSASALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDPAIRETMLQALRGVLTPAGDKMTEPMRRQVFATLSGMLVYPEDVTRNAAAGCYGAILKWLTPEQLATAFNDHLLCNDVNADWILRHGRSAALFVALKEAPETVYTNKEKDRVCKVILSYLAADKVQIAMNGVRVCGYLFQYLMNEGQPIPQQILTPFVRSMNHSSNDVKQLLARVCIHLARNISSEKMSPELLKSLLPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEHQRCMALLDVGAKESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2649          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|954548895|ref|XP_014597750.1| (PREDICTED: translational activator GCN1 [Polistes canadensis])

HSP 1 Score: 4113.1 bits (10666), Expect = 0.000e+0
Identity = 2183/2650 (82.38%), Postives = 2392/2650 (90.26%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MAD ELT+ALKDLPNRIQTA KKERREI +NV++VLSNP INDKI+ GICK+ S+TLHRYKDTASQSYVK +I  ++ + PE  +KH+ +VI EQA WHKNVV T NTAL+AYLALKWSTL++ HG +K+ ++   EL K+IEAQANLSAA++ASMDKK++ K Y+LL+H+W    N + +Y++ L  LE  NGVIVLASL TKYL++  K +L +  K  ++D+FIKV IS KKKP LYVV+ A P LRR++H++FK QLLPALQK+MLRNPEIII+SVGHILSGLSLDLS+YS++I KGLFANLHSKED VRE A  ACRRLA QCSDT ALE LLASLFAVFHGSEGKLT+VTHKISVLQGAGNLS NAASGS VQ +AE AC HFIKVLETEVHEKTLIHAL+MM LW  KF N  P+SVI+ FKKG+AAK+STA VRTAYIKL  S  V S++ T++PIL+QAITRA+QQ++QP  VTEGLVA++LLLK V+A  VENDKQ +LWNAIDEQIFF EKFL+TC DD LY+LM  CE+LI E+ DRLNEKAL+G+HRAIVAC TAPKS+ R+RC PL KK+LTGL TY P +ALL+EFNK+L N +I  E D++NK++    GE+TGRSLADGLLA+CSGSFLFE PA++L  D+LIPAHHPAIL+AVPNLW KI KNF+L P+DFL     ++K + I NY   PSYENAL  ++ L+PD +L  L+ NVT+KL+D EIL+VTKDEYFTYLTP+GELYDKSV+P NDENDILN+MNMKRESKVYSFKEQQEELQLRRELYEK KREGKIKEPKLTAKQEE LK+QIA+EN+IRKRL E +SKI  AVS++  AI G+    S YLKD+L+PILKNL SPLAAP +S+LYIEL +IV+I  D T+ +L+AHVTLRQL+PQCDL+ AW++E+L+  V RTLNL+H  T++QK+L  APAFCYIFPF+ KTLL ++D+ +I++GLQI+Q+HAKQRG  +D +D RHPRLLPRKQ+FDLLIELMSST GR+QSHAVAT LDVA+SGSG    A A+ D+IDSL+GALQN LPAVRDAALR L +++ AFPS+KED  QLLRLTRR+WIA+FD  DENK+LA+ELW A+   A  +ILC+ LI+D+AHPVE VQQAAA A+AQ L + P L P ILD LLELYQEKLAMIPPKLNDFGRVVEQPIDTW PRRGVALAL QLAPLLT ETI RLV+FFVSTGLGDRN SVRTEML AAVAAVD HGK NITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTP+QQVQEAV NCLPHLVPSIKEDAP+IVDNLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX      SSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSH+AIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GL S QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVMAIKSRVVLPYLVPQLT+ PVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNE QELEYCQAVILS+TDEVGVRTVMDQLM+AT++ D SRRRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDEDK+VLQ SWEALTAVTKTL SDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+PEAKEQAAQGLGEVIKLTSA+ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMTEPM+KQVFVTL+SMLGHP+D+TR AVAGC+GALLRWLSPEQLA AFN+NLLCND NADW LRHGRSAALFV LKESPAT++ A E++R C VILSYLAADRVQI MNGVRACGYLFQYLM EN+ +P  +L+PFVRSMNNNSNDVKQLLARVC H+ARNIPP+KMSPELLKAL+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADVELTKALKDLPNRIQTASKKERREILQNVVDVLSNPGINDKIVYGICKVLSLTLHRYKDTASQSYVKNVITKLLAEQPEATVKHMTSVIAEQATWHKNVVSTLNTALTAYLALKWSTLVILHGINKNFENC-TELAKLIEAQANLSAASLASMDKKMSYKTYALLAHEWSSVKNIEIKYVETLVKLEIGNGVIVLASLLTKYLVNTKKSELIEQLKKNVIDTFIKVTISSKKKPDLYVVDTAVPLLRRMSHEEFKVQLLPALQKAMLRNPEIIIESVGHILSGLSLDLSQYSQDICKGLFANLHSKEDLVREEAVGACRRLARQCSDTTALESLLASLFAVFHGSEGKLTVVTHKISVLQGAGNLSYNAASGSSVQRLAETACEHFIKVLETEVHEKTLIHALDMMALWSNKFTNSFPQSVIDAFKKGIAAKTSTAAVRTAYIKLFFSTPVDSYAGTIAPILTQAITRAIQQSSQPMPVTEGLVASYLLLKFVLADLVENDKQTILWNAIDEQIFFSEKFLTTCGDDTLYHLMLLCERLITEFVDRLNEKALNGIHRAIVACSTAPKSAIRKRCCPLIKKVLTGLSTYAPVEALLVEFNKYLNNVKIKIENDKDNKED--TFGEITGRSLADGLLAICSGSFLFELPAMQLTRDALIPAHHPAILRAVPNLWLKIAKNFNLVPKDFLRTYSNEIKKLLIQNYNPVPSYENALAKVLQLSPDTILPTLILNVTNKLNDQEILKVTKDEYFTYLTPEGELYDKSVLPTNDENDILNAMNMKRESKVYSFKEQQEELQLRRELYEKHKREGKIKEPKLTAKQEEILKAQIAKENSIRKRLTELKSKIDHAVSLILCAIRGNGQELSLYLKDILSPILKNLGSPLAAPAISELYIELREIVQIGTDTTLGNLIAHVTLRQLQPQCDLDPAWEDENLDVVVKRTLNLIHTITIKQKRLFTAPAFCYIFPFLKKTLLMYEDDVMIAQGLQIIQDHAKQRGNSSDLKDMRHPRLLPRKQIFDLLIELMSSTTGRVQSHAVATLLDVAQSGSGQPGTALATSDDIDSLIGALQNALPAVRDAALRGLTVIRQAFPSQKEDPLQLLRLTRRIWIARFDVCDENKILANELWSAANLLAHADILCDNLIEDIAHPVEPVQQAAACALAQSLTNVPYLTPSILDRLLELYQEKLAMIPPKLNDFGRVVEQPIDTWAPRRGVALALTQLAPLLTSETIQRLVQFFVSTGLGDRNPSVRTEMLNAAVAAVDLHGKKNITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPAQQVQEAVGNCLPHLVPSIKEDAPKIVDNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRTATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHFAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLLSEQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMAIKSRVVLPYLVPQLTTPPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEVQELEYCQAVILSVTDEVGVRTVMDQLMEATRSSDASRRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDKDVLQMSWEALTAVTKTLASDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPEAKEQAAQGLGEVIKLTSASALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTEPMKKQVFVTLNSMLGHPEDITRNAVAGCFGALLRWLSPEQLAIAFNDNLLCNDVNADWTLRHGRSAALFVALKESPATVFNAKEKDRVCTVILSYLAADRVQIVMNGVRACGYLFQYLMHENMSVPQQVLSPFVRSMNNNSNDVKQLLARVCIHLARNIPPAKMSPELLKALLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2647          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|972201909|ref|XP_015183054.1| (PREDICTED: translational activator GCN1 [Polistes dominula])

HSP 1 Score: 4111.6 bits (10662), Expect = 0.000e+0
Identity = 2182/2650 (82.34%), Postives = 2390/2650 (90.19%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MAD ELT+ALKDLPNRIQTA KKERREI +NV++VLSNP INDKI+ GICK+ S+TLHRYKDTASQSYVK +I  ++ + PE  +KH+ +VI EQA WHKNVV T NTAL+AYLALKWSTL++ HG +K+ ++   EL K+IEAQANLSAA++ASMDKK++ K Y+LL+H+W    + + +Y++ L  LE  NGVIVLASL TKYL++  K +L +  K  ++D+FIKV IS KKKP LYVV+ A P LRR++H++FK QLLPALQK+MLRNPEIII+SVGHILSGLSLDLS+YS++I KGLFANLHSKED VRE A  ACRRLA QCSDT ALE LLASLFAVFHGSEGKLT+VTHKISVLQGAGNLS NAASGS VQ +AE AC HFIKVLETEVHEKTLIHAL+MM LW  KF N VP+SVI+ FKKG+AAK+STA VRTAYIKL  S  V S+S T++PIL+QAITRA+QQ++QP  VTEGLVA++LLLK V+A  VENDKQ +LWNAIDEQIFF EKFL+TC DD LY+LM  CE+LI E+ DRLNEKAL+G+HRAIVAC TAPKS+ R+RC PL KK+LTGL TY P +ALL+EFNK+L+N +I  E D++NK++    GE+TGRSLADGLLA+CSGSFLFE PA++L  D+LIPAHHPAIL+AVPNLW KI KNF+L P+DFL     ++K + I NY   PSYENAL  ++ L+PD +L  L+ NVT+KL+D EIL+VTKDEYFTYLTP+GELYDKSV+P NDENDILN+MNMKRESKVYSFKEQQEELQLRRELYEK KREGKIKEPKLTAKQEE LK+QIA+EN IRKRL E +SKI  AVS++  AI G+    S YLKD+L+PILKNL SPLAAP +S+LYIEL KIV+I  D T+ +L+AHVTLRQL+PQCDL+ AW++E+L+  V RTLNL+H  T++QK+L  APAFCYIFPF+ KTLL ++D+ +I +GLQI+QEHAKQRG  +D +D RHPRLLPRKQ+FDLLIELMSST GR+QSHAV T LDVA+SGSG    A A+ D+IDSL+GALQN LPAVRDAALR L +++ AFPSEKED  QLLRLTRR+WIA+FD  DENK LA+ELW A+   A  ++LC++LIQD+AHPVE VQQAAA A+AQ L + P L P ILD LLELYQEKLAMIPPKLNDFGRVVEQPIDTW PRRGVALAL Q+APLLT ETI RLV+FFVSTGLGDRN SVRTEML AAVAAVD HGK NITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAV NCLPHLVPSIKEDA +IVDNLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX      SSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSH+AIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GL S QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVMAIKSRVVLPYLVPQLT+ PVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNE QELEYCQAVILS+TDEVGVRTVMDQLM+AT+++D SRRRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDEDK+VLQ SWEALTAVTKTL SDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+PEAKEQAAQGLGEVIKLTSA+ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMTEPM+KQVF+TL+SMLGHP+D+TR AVAGC+GALLRWLSPEQLA AFN+NLLCND NADW LRHGRSAALFV LKESPAT++   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM EN+ +P  +L+PFVRSMNNNSNDVKQLLARVC H+ARNIPP+KMSPELLKAL+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GA+ESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADVELTKALKDLPNRIQTASKKERREILQNVVDVLSNPGINDKIVCGICKVLSLTLHRYKDTASQSYVKNVITKLLAEQPEATVKHMTSVIAEQATWHKNVVSTLNTALTAYLALKWSTLVILHGINKNFENC-TELAKLIEAQANLSAASLASMDKKMSYKTYALLAHEWSSVKDIEIKYVETLVKLEIGNGVIVLASLLTKYLVNTKKSELIEQLKKNVIDTFIKVTISSKKKPDLYVVDTAVPLLRRMSHEEFKVQLLPALQKAMLRNPEIIIESVGHILSGLSLDLSQYSQDICKGLFANLHSKEDLVREEAVGACRRLARQCSDTTALESLLASLFAVFHGSEGKLTVVTHKISVLQGAGNLSYNAASGSSVQRLAETACEHFIKVLETEVHEKTLIHALDMMALWSNKFTNSVPQSVIDAFKKGIAAKTSTAAVRTAYIKLFFSAPVDSYSGTIAPILTQAITRAIQQSSQPMPVTEGLVASYLLLKFVLADLVENDKQTILWNAIDEQIFFSEKFLTTCGDDTLYHLMLLCERLITEFVDRLNEKALNGIHRAIVACSTAPKSAIRKRCFPLIKKILTGLSTYAPVEALLIEFNKYLKNVKIKIENDKDNKED--TCGEITGRSLADGLLAICSGSFLFELPAMQLTRDALIPAHHPAILRAVPNLWLKIAKNFNLVPKDFLRTYSNEIKKLLIQNYNPVPSYENALAKVLQLSPDTILPTLILNVTNKLNDQEILKVTKDEYFTYLTPEGELYDKSVLPTNDENDILNAMNMKRESKVYSFKEQQEELQLRRELYEKHKREGKIKEPKLTAKQEEILKAQIAKENGIRKRLTELKSKIDHAVSLILCAIRGNGQELSLYLKDILSPILKNLGSPLAAPAISELYIELQKIVQIGTDTTLGNLIAHVTLRQLQPQCDLDPAWEDENLDVVVKRTLNLIHTITIKQKRLFTAPAFCYIFPFLKKTLLMYEDDVMIMQGLQIIQEHAKQRGNTSDLKDMRHPRLLPRKQIFDLLIELMSSTTGRVQSHAVTTLLDVAQSGSGQPGTALATSDDIDSLIGALQNALPAVRDAALRGLKVIRQAFPSEKEDPAQLLRLTRRIWIARFDVCDENKTLANELWSAANLLAQADVLCDDLIQDIAHPVEPVQQAAACALAQSLTNVPYLTPSILDRLLELYQEKLAMIPPKLNDFGRVVEQPIDTWAPRRGVALALTQIAPLLTSETIQRLVQFFVSTGLGDRNPSVRTEMLNAAVAAVDLHGKKNITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVGNCLPHLVPSIKEDASKIVDNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRTATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHFAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLLSEQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMAIKSRVVLPYLVPQLTTPPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEVQELEYCQAVILSVTDEVGVRTVMDQLMEATRSNDASRRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDKDVLQMSWEALTAVTKTLASDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPEAKEQAAQGLGEVIKLTSASALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTEPMKKQVFLTLNSMLGHPEDITRNAVAGCFGALLRWLSPEQLAIAFNDNLLCNDVNADWTLRHGRSAALFVALKESPATVFNDKEKDRVCTVILSYLAADRVQIVMNGVRACGYLFQYLMQENMSVPQQVLSPFVRSMNNNSNDVKQLLARVCIHLARNIPPAKMSPELLKALLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGAKESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2647          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|749734041|ref|XP_011149210.1| (eIF-2-alpha kinase activator GCN1 [Harpegnathos saltator] >gi|1126580134|ref|XP_019699556.1| eIF-2-alpha kinase activator GCN1 [Harpegnathos saltator])

HSP 1 Score: 4093.5 bits (10615), Expect = 0.000e+0
Identity = 2165/2650 (81.70%), Postives = 2386/2650 (90.04%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MADAEL +ALKDLPNR+QTA KKERRE+ +NV+NVLSNP IN+KI+ G+CK+ S+TLHRYKD+ASQSYV+ LIV ++K+ P+  +KH+ AV+TEQA WHKNVV T NT+L+AY+ALKWSTL++ HG +++  + +  LPK+IEAQANLSAAAVAS D++L++KVY+LL+H+W    N +  Y++ L+ LE  NG I+LASL TKYL+++ +  L +  KV ++D FIKV ISCKKKP LYVV+ A P LRRLTH++FK  LLPALQK+MLRNPEIII+SVGHIL+GLSLDLS+Y +EISKGLFANLHSKED VR+ A  ACR+LALQCSDT ALE LL+S+FAVFHGSEGKLT+ THKISVLQGAGNLS NAASGS VQ +AE AC HF+KVLETEVHEKTLIHALEMM LW  KF + VPKSV++ FKKGMAAK+STA VRTAYIKL  S    S++  ++P L+QAI+RAMQQ AQP  VTEGLVA++LLLK V+A +VENDKQ+VLW+AIDEQIFF EKFLSTC DDILY+LM  CE+LI E++DRLNEKAL+GVHRAIV+C TAP SSTR+RC PL KK++TGL TY PAQALL EFNKFLEN +I  E D+E++DE    GE+TGR LADGL A+CSGSFLF+ PA+++  DSL+P+HHPA+LKAVPNLW KI KN+   P+DFL     +V+ M I NYR   +YENAL  +VSL PD  L ALV+NV SKLDDPEILRVTKDEYFTYLTP+GELYDKSV+P NDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEE LK+QIA+EN IRKRL E ++KI  AVS++  +I G++   S +LKDLL  ILKNL SPLAAP M++LY+ L + V I     +  L+AHVTLRQL+PQCDL+ AW+EE+L+ AV RTLNL+H  T+++K+L  A AFCY+FPFV KTLLT+KD+ +I +GLQ +QEH KQRG+ N+ +DPRHPRLLPRKQMFDLLIELM  T GR+QSHAVAT LDVA SGSG  + A A+ ++IDSL+GALQN+L  VRDAALR L +++ AFPS KED +QL RLTRRVWIA+FD SDENK+LA+ELW+A+   A  E+LC+ELIQD+AHPVE VQQAAA A+AQ L + P L P +LD+LL+LYQEKLAMIPPKLNDFGRV+EQPIDTWGPRRGVALALAQ+APLLT +TI+RLV+FFVSTGLGDRN SVRTEML AAVAAVD HGK N+TSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP+IVDNLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX    GESSFEDLLPWLMQTLTSE+SSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GLQS+QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPD +EAENTLDGLRQVMAIKSRVVLPYLVPQL S PVNTKALSILASVAGEALTRFLH+ILPALLTALSSAQGT NE QELEYCQAV+LS+TDEVGVRTVMDQLM+AT+A+D+S+RRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDEDK+VLQ SWEALTAVTKTL S+QQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+PEAKE AAQGLGEVI+L+SA+ALQPSVV ITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMT+PM+KQVF TLSSML HP+DVTR AVAGC+GALLRWLSPEQLA  FN++LLCND NADWMLRHGRSAALFV LKESPAT+Y   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM E  P+P  IL+PFVRSMNNNSNDVKQLLARVC H+ARNI P KMSPELL+AL+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADAELAKALKDLPNRVQTASKKERREVLQNVVNVLSNPGINEKIVNGVCKVLSLTLHRYKDSASQSYVRNLIVELLKKQPDATVKHMTAVVTEQATWHKNVVATLNTSLTAYIALKWSTLVILHGYNEEMDTTQ-ILPKLIEAQANLSAAAVASNDERLSNKVYTLLAHEWTTIKNIEIIYVENLTKLEIGNGTIILASLLTKYLVASKRNDLVEQLKVNMIDIFIKVTISCKKKPDLYVVDVAVPLLRRLTHEEFKIHLLPALQKAMLRNPEIIIESVGHILNGLSLDLSQYCQEISKGLFANLHSKEDLVRDNAVGACRKLALQCSDTTALESLLSSVFAVFHGSEGKLTVATHKISVLQGAGNLSYNAASGSSVQKLAETACEHFVKVLETEVHEKTLIHALEMMALWSKKFSSNVPKSVVDAFKKGMAAKTSTAAVRTAYIKLFFSTPATSYAGVIAPTLAQAISRAMQQCAQPTAVTEGLVASYLLLKFVLADQVENDKQSVLWSAIDEQIFFSEKFLSTCGDDILYHLMLLCERLISEFSDRLNEKALNGVHRAIVSCATAPNSSTRQRCFPLVKKVVTGLSTYAPAQALLTEFNKFLENVKIKSEADKESRDES-SMGEITGRCLADGLFALCSGSFLFDVPAMQMTRDSLLPSHHPALLKAVPNLWFKIAKNYSFIPKDFLRSYSSEVRKMLIQNYRPLANYENALIKVVSLAPDAFLPALVSNVISKLDDPEILRVTKDEYFTYLTPEGELYDKSVLPVNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEETLKAQIAKENGIRKRLTELKAKIDTAVSLVTCSIRGNRQELSLHLKDLLPSILKNLGSPLAAPEMAELYLSLRQTVTIDNSAILGDLIAHVTLRQLQPQCDLDPAWEEENLDVAVKRTLNLIHTVTIKKKELFTASAFCYVFPFVRKTLLTYKDDGMIVQGLQFIQEHTKQRGSTNELKDPRHPRLLPRKQMFDLLIELMEKTTGRVQSHAVATLLDVAHSGSGQPNTAIATSEDIDSLIGALQNSLSTVRDAALRGLAVIRQAFPSHKEDEDQLDRLTRRVWIARFDVSDENKILANELWDAAELTARAEVLCDELIQDIAHPVEPVQQAAAYALAQCLATVPHLTPSVLDNLLQLYQEKLAMIPPKLNDFGRVIEQPIDTWGPRRGVALALAQIAPLLTADTIHRLVQFFVSTGLGDRNQSVRTEMLTAAVAAVDLHGKVNVTSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPKIVDNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESSFEDLLPWLMQTLTSESSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLQSDQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDSAEAENTLDGLRQVMAIKSRVVLPYLVPQLASPPVNTKALSILASVAGEALTRFLHRILPALLTALSSAQGTANELQELEYCQAVVLSVTDEVGVRTVMDQLMEATRAEDLSKRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDKDVLQMSWEALTAVTKTLSSEQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPEAKEHAAQGLGEVIRLSSASALQPSVVQITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTDPMKKQVFATLSSMLSHPEDVTRNAVAGCFGALLRWLSPEQLAITFNDHLLCNDVNADWMLRHGRSAALFVTLKESPATVYNPKEKDRVCTVILSYLAADRVQIVMNGVRACGYLFQYLMNEAQPVPQQILSPFVRSMNNNSNDVKQLLARVCIHLARNILPEKMSPELLRALLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2648          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|769834005|ref|XP_011647093.1| (eIF-2-alpha kinase activator GCN1 [Pogonomyrmex barbatus])

HSP 1 Score: 4092.3 bits (10612), Expect = 0.000e+0
Identity = 2172/2651 (81.93%), Postives = 2380/2651 (89.78%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDE-LPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MAD ELT+ALKDLPNR QTA KKERREI +NV++VLSNP INDKI+ GICK+ S+TLHRYKD+ASQSYV+ LIV +IKQ PE  IKH+  VI+EQA WHKNVVPT NTAL+AY+ALKWSTLL+ HG ++   +  DE L K+IEAQANLSAAA+AS DKKL +KVY+LL+H+W   AN  E Y   L+ LE  NGVI+LASL T+YL++  +  L +  K  ++D FIKV ISCKKKP LYVV+AA P LRRLTH++FK QLLPALQK+MLRNPEIII+SVGHIL+GLSLDLS+YS+EISKGLFANLHSKED VR+ A EACR+LALQCSDT ALE LL+S+FAVFHGSEGKLT+ THKISVLQGAGNLS N ASGS VQ +AE AC HF+KVLETEVHEKTLIHALEMM LW  KF   V K V++ FKKGMAAK+STA VRTAYIKL  S  V S+S  ++PIL+QAITRAMQQ AQP  VTEGLVA++LLLK V+A +VENDKQ+VLWNAIDEQIFF EKFLSTCSDDILY+LM  CE+LI E++D+LNEKAL+G+HRAIV+C TAP S+TR+RC PL KK++TGL TY PAQALL EFNKFLEN +I  E D+ENK+E    GE+TGR LADGL A+CSGSFLFE P+ ++  D+L+P+HHPA+LKAVPNLW KI KN++L P+DFL     +V+ M I NY+  P+YENAL  IVSL PD  L ALV+NVTSKLDDPEILRVTKDEYFTYLTP+GELYDKSV+P NDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEE +K+QIA+EN IRKRL E ++KI   VS++  +I G++   S YLKDLL PILKNL SPLAAP MS+LYI L + V +    T+  L+AHVTLRQL+PQCDL+ AW+EE+L+ AV RTLNL+H  T+++K+L  APAFCY+FPF+ KTL ++KDE +I +GLQ++QEHAKQRG+  D +D RHPRLLPRKQMFDLLIELM +T  R+QSHAVAT LDVA+SGSG    A A+ ++IDSL+GALQN+LP VRDAALR L ++  AFPS+KED +QL RLTRRVWIA+FD +DENK+LA+ELW  + F A  E LCEELIQD+AHPVE VQQAAA A+AQ L + P L P +LD+LL+LYQEKLAMIPPKLNDFGRV+EQPIDTWGPRRGVALALAQ+APLLT +T++RL++FFV TGLGDRN SVRTEML AAVAAVD HG ANITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+K+DPRIKPIVMRLIAALSTPSQQVQEAVANCLP+L  SIKEDAP+IVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIM+ LT AIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX      SSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GLQS+QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPD +EAENTLDGLRQVMAIKSRVVLPYLVPQL S PVNTKALSILASVAGEALTRFLH+ILPALLTALSSAQGT NE QELEYCQAV+LS+TDEVGVRTVMDQLM+AT+A+D+S+RRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDED++VLQ SWEALTAVTKTL S+QQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+PEAKE AAQGLGEVI+L+SA ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMT+PM+KQVF TLSSMLGHP+D+TR AVAGC+GALLRWL+PEQLA AFN++LLCND NADW+LRHGRSAALFV LKESP T+Y   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM E+ PIP  IL+PFVRSMNNNSNDVKQLLARVC H+ARNIPP  MSPELL+AL+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GA ESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADVELTKALKDLPNRAQTASKKERREILQNVVSVLSNPGINDKIVNGICKVVSLTLHRYKDSASQSYVRNLIVELIKQQPEATIKHMTTVISEQATWHKNVVPTLNTALTAYIALKWSTLLIFHGYNEHHVTQMDESLAKLIEAQANLSAAALASADKKLTNKVYTLLAHEWVAIANI-ETYAGHLTKLELGNGVIILASLLTRYLVTTKRSDLVEQLKTNMIDVFIKVTISCKKKPDLYVVDAAVPLLRRLTHEEFKTQLLPALQKAMLRNPEIIIESVGHILNGLSLDLSQYSQEISKGLFANLHSKEDLVRDEAVEACRKLALQCSDTTALETLLSSVFAVFHGSEGKLTVATHKISVLQGAGNLSYNVASGSSVQKLAETACEHFVKVLETEVHEKTLIHALEMMALWSKKFSTTVSKIVVDAFKKGMAAKTSTAAVRTAYIKLFFSTPVASYSGVIAPILAQAITRAMQQCAQPAAVTEGLVASYLLLKFVLADQVENDKQSVLWNAIDEQIFFSEKFLSTCSDDILYHLMLLCERLITEFSDKLNEKALTGIHRAIVSCATAPNSATRQRCLPLVKKIMTGLSTYAPAQALLTEFNKFLENVKIKSESDKENKEE-TSMGEITGRCLADGLFAICSGSFLFETPSYQMTRDALLPSHHPALLKAVPNLWFKIAKNYNLVPKDFLRSYSNEVRKMLIQNYKPVPTYENALIRIVSLAPDAFLPALVSNVTSKLDDPEILRVTKDEYFTYLTPEGELYDKSVLPVNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEETIKAQIAKENGIRKRLTELKAKIDNTVSLVTCSIRGNQQELSLYLKDLLPPILKNLGSPLAAPEMSELYISLRQTVTLDNSATLGDLIAHVTLRQLQPQCDLDQAWEEENLDVAVKRTLNLIHGVTIKKKELFTAPAFCYVFPFIRKTLTSYKDEGMIVQGLQLIQEHAKQRGSTTDLKDLRHPRLLPRKQMFDLLIELMETTTSRVQSHAVATLLDVAQSGSGQPGTAIATSEDIDSLIGALQNSLPTVRDAALRGLTVIWQAFPSQKEDQDQLDRLTRRVWIARFDVNDENKILANELWNTADFTAQAEALCEELIQDIAHPVEPVQQAAAHALAQSLANVPHLTPTVLDNLLQLYQEKLAMIPPKLNDFGRVIEQPIDTWGPRRGVALALAQIAPLLTADTVHRLIQFFVLTGLGDRNQSVRTEMLTAAVAAVDLHGSANITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKNDPRIKPIVMRLIAALSTPSQQVQEAVANCLPYLTDSIKEDAPKIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMSKLTTAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRTATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLQSDQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDPAEAENTLDGLRQVMAIKSRVVLPYLVPQLASPPVNTKALSILASVAGEALTRFLHRILPALLTALSSAQGTANELQELEYCQAVVLSVTDEVGVRTVMDQLMEATRAEDLSKRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDRDVLQMSWEALTAVTKTLSSEQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPEAKEHAAQGLGEVIRLSSAAALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTDPMKKQVFATLSSMLGHPEDITRNAVAGCFGALLRWLTPEQLAVAFNDHLLCNDVNADWVLRHGRSAALFVALKESPGTVYNPKEKDRVCAVILSYLAADRVQIVMNGVRACGYLFQYLMNESQPIPQQILSPFVRSMNNNSNDVKQLLARVCIHLARNIPPENMSPELLRALLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGAGESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2649          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|805778182|ref|XP_012138451.1| (PREDICTED: translational activator GCN1 isoform X2 [Megachile rotundata])

HSP 1 Score: 4092.0 bits (10611), Expect = 0.000e+0
Identity = 2175/2650 (82.08%), Postives = 2380/2650 (89.81%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MAD EL +ALKDLPNR+QTA K ERREI +NV+NVLSNP IN+KI+ GICK  S+TLHRYKDTASQSYVK +IV ++K+ PE  +KH+  V+ EQA WHKNVVPT NTAL+AYL LKWSTL+V +G  K++  +  ELPK+IE QANLSAAA+ASMDKKL +KVY LL+HQW    + D  YL+ L+ LE  NGVIVLASL  +YL++  K +L    KV I+D FIKVAISCKKKP LYVV  A P LRR++HD+FK+QLLPALQK+MLRNPEIII+SVG+ILSGLSLDLS+YS++ISKGLFANLHSKED VRE A  ACRRLALQCSDT ALE LL+S+FAVFHGSEGKLT+ THKISVLQGAGNLS NAASGS VQ +AE AC HFIKVLETEVHEKTLI+ALEMM LW  KF N VPKSVI+ FKKGM AK+STA VRTAYI+L  S  V S+S  ++P+L QAITRA+QQ AQ   VTEGLVA++LL+KL++A +VENDKQ VLWNAIDEQIFF EKFLSTC DDILY+LM FCE+LI+E+ DRLNEKAL+GVHRAIV C TAPK STR+RC PL KK+LTGL TY+P Q LL+EFNKFLEN +I  E D+ENK++   +GE+TGR LADGLLA+CSGSFLFE PA+++  D+LIP+HHPAILKA+PNLW KI KN++L P+DFL     ++K M + NY+   SYENAL  ++S+ PD+++ A+V+NVT+KLDDPEIL+VTKDEYFTYLTP+GELYDKSV+P NDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRK+EGKIKEPKLT KQEE LK+Q+ +E+AIRK+L E + KI  AVS++K ++ G+    S +LKDL   ILKNL S LAAP MS LYI L +IV I  +  +S LVAHVTLRQL+PQCDL  AW+EE+L+ AV RTLNLLH+ T++QK+L  APAFCYIFPF+ KTLL +KD+++I +GLQI+QEHAKQRG  +DF D RHP+LLPRK MFDLLIELM  T GR+Q+HAVAT LDVA+SGSG    A A+ ++I+SL GALQN+L  +RDAALRAL +V+ AFPS+KE  EQ  RL RR+WIA+FD  DENK+LA+ELW A+  A  P+IL  ELIQD++HPVE +QQAAA A+AQ L   P L+P ILD+LL+LYQEKLAMIPPKLN+FGRVVEQPIDTWGPRRGVALALAQ+APLLT +T+ +LV+FFVSTGLGDRN +VRTEML AAVA VD HGK NITSLLPVFE FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP+IV+NLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX      SSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GLQS+QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVMAIKSRVVLPYLVPQLT+ PVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNE QELEYCQAVILS+TDEVGVRTVMDQLM+AT+ADD S+RRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTD+DK+VLQ SWEALTAVTKTL SDQQIAHVQDIRQAVRFAVSDL+GQELLPGFCLPKGITPILPIFREAILNG+PEAKEQAAQGLGEVIKLTSA ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMTEPM+KQVF TLSSMLGHP+DVTR AVAGC+GAL+RWLSP+QLA AFN++LLCND + DWMLRHGRSAALFV LKESP TIY   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM E  PIP  IL+PFVRSMNNNSNDVKQLLARVC H+ARNIPP KMSPELLK+L+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADVELAKALKDLPNRVQTASKNERREILQNVVNVLSNPGINEKIVNGICKTVSLTLHRYKDTASQSYVKNVIVELLKKQPEATVKHMTNVVIEQATWHKNVVPTLNTALTAYLTLKWSTLIVLYG-YKNNLDINAELPKLIEVQANLSAAALASMDKKLTEKVYILLAHQWSTVKDIDIIYLETLTKLEVGNGVIVLASLLARYLVNAKKSELIGKLKVDIIDVFIKVAISCKKKPDLYVVHNAAPLLRRISHDEFKNQLLPALQKAMLRNPEIIIESVGYILSGLSLDLSQYSQDISKGLFANLHSKEDIVREEAVGACRRLALQCSDTTALENLLSSVFAVFHGSEGKLTVTTHKISVLQGAGNLSYNAASGSSVQRLAETACEHFIKVLETEVHEKTLIYALEMMALWSNKFTNNVPKSVIDAFKKGMTAKTSTAAVRTAYIRLFFSTPVASYSGIITPLLVQAITRAIQQCAQSAAVTEGLVASYLLVKLILANQVENDKQAVLWNAIDEQIFFSEKFLSTCGDDILYHLMLFCERLIIEFGDRLNEKALNGVHRAIVICATAPKYSTRKRCFPLIKKILTGLSTYKPVQELLMEFNKFLENVKIKSENDKENKEDS-STGEITGRCLADGLLAICSGSFLFEAPAIQITRDALIPSHHPAILKAMPNLWFKIAKNYNLVPKDFLCSLNNEIKKMLVQNYKPVASYENALTKVISIIPDIIIPAIVSNVTNKLDDPEILKVTKDEYFTYLTPEGELYDKSVLPTNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKKEGKIKEPKLTPKQEEILKTQMGKESAIRKKLTELKHKIDNAVSLIKCSVHGNGQELSLHLKDLFPSILKNLRSLLAAPAMSDLYIYLKQIVNINNNPVLSDLVAHVTLRQLQPQCDLNPAWEEENLDTAVKRTLNLLHSTTIKQKKLFTAPAFCYIFPFIRKTLLCYKDDNMIVQGLQIIQEHAKQRG-NSDFRDTRHPQLLPRKHMFDLLIELMEITTGRVQTHAVATLLDVAQSGSGQPGTALATNEDINSLTGALQNSLSTIRDAALRALTVVRQAFPSKKEHSEQFSRLIRRIWIARFDICDENKILANELWHAADLAMEPDILATELIQDISHPVEPIQQAAACALAQCLSEVPHLVPTILDNLLQLYQEKLAMIPPKLNNFGRVVEQPIDTWGPRRGVALALAQIAPLLTADTVLKLVQFFVSTGLGDRNQAVRTEMLTAAVAVVDLHGKTNITSLLPVFEEFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPKIVNNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLQSDQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMAIKSRVVLPYLVPQLTTPPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEVQELEYCQAVILSVTDEVGVRTVMDQLMEATRADDPSKRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDDDKDVLQMSWEALTAVTKTLASDQQIAHVQDIRQAVRFAVSDLRGQELLPGFCLPKGITPILPIFREAILNGLPEAKEQAAQGLGEVIKLTSATALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTEPMKKQVFATLSSMLGHPEDVTRNAVAGCFGALVRWLSPDQLAIAFNDHLLCNDTSVDWMLRHGRSAALFVALKESPTTIYNDKEKDRVCTVILSYLAADRVQIVMNGVRACGYLFQYLMNEARPIPQQILSPFVRSMNNNSNDVKQLLARVCIHLARNIPPEKMSPELLKSLLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2647          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|1389706728|ref|XP_024940665.1| (eIF-2-alpha kinase activator GCN1 isoform X2 [Cephus cinctus])

HSP 1 Score: 4091.2 bits (10609), Expect = 0.000e+0
Identity = 2165/2574 (84.11%), Postives = 2363/2574 (91.80%), Query Frame = 0
Query:   77 IKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            I +  E  IKH++  ITEQAVWHKNVVPT NTAL+AYL LKWS L+V+HG +  S+    ELPK+IEAQ NLSAAA+AS +KKL++KVY+L +H+WK+    +E+Y++VL  LEASNGVIVLASL T+YL+   K+ L D  K  ++++ IKV+ISCKKKP+LYVV+AA   L+R++H++FK+ LLPALQK+MLRNPEIII+SVG ILSG+SLDLS+YS++ISKGLFANLHSKED VR+ AA+ACRRLALQCSD+ ALE LL+SLFAVFHGSEGKLT+ THKISVLQGAGNLS N  SGS +Q + E AC HFIKVLETEVHEKTLIHALEMM+LWC KF N +PKSVI+ FKKGMAAK+STAGVRTAYIKL+    + SHSA ++PIL+QAITRA  Q+AQP  VTEGL+A +LLLKLV+AG+VENDKQ++LWNA+D+Q+FF EKFLSTC DDILY LM  CE+L+ E++DRLNEKAL G++RAIVACVTAPKSS RR+CAP+ KK+LTGL +YE  +ALLLEFNKFLE A+I  + ++E+K+E   SGEV+GRSLADGL+A+CSGSFLFE P++++  D+LIPAHHP I +AVPNLW KI +NF L P+DFL     ++K +F++NY+  PSYENAL +++SL PD++L +L++NVT KLDDPEILRVTKDEYFTYLTP+GELYDKSVIPGNDENDILN+MNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEEALK+Q A+E+ IRKRL E  +KIT AVSM+ AA  G+ F    +LKDLL PILK+L SPLAAPTM QLYI L K V+I+ + T+S L+AHVTLRQL+PQCDL+ AW+EE L++AV RTL L+H YT+RQK L  AP FCYIF F+ KTLL+ KD+ +I++GLQIVQEHAKQRG  +  +D RHP+LLPRKQMFDLLIELMS+T GR+QS AVAT LDVA+SGSG  +CA A+G++IDSL GALQN+LPAVRDAALR LMI++LAFPSEKEDY QLLRLTRR+W+AKFD  +ENK LA+ELW A+G  A+P+ILCEELIQD+AHPVE +QQAAA A+AQLL   P+LMP ILD LLELYQ+KLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETI+RLV+FFVSTGLGDRN +VRTEML AAVAAVD HGKANITSLLPVFE+FMDKAPKIGSFDSIKQSVVILMG LARHLEKDDPRIKPIV+RLI+ALSTPSQQVQEAVANCLPHLVPSIK+DAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTP+TLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQS QADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQ+EAENTLDGLRQVMAIKSRVVLPYLVPQLTS PVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNE QELEYCQAVILS+TDEVGVRTVMDQLM+AT+A+D SRRRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTD+DK+VLQ SWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKG ELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVI+LTSA ALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELH GIKT+DD  IRETMLQALRGVLTPAGDKMTEPMRKQVF TLS+MLG+ +DVTR AVAGCYGALLRWL+PEQLA AFN+NLLCND NADWMLRHGRSAALFVVLKESP T+Y   E+ER CKVILSYLAADRVQIAMNGVRACGYLFQYLM +  PIP  ILTPFVRSMN+ +NDVKQLLARVCTH+ARNIP  KMSPELLKAL+PMLVNGTKEKNGYVKANSELALIAVLRLK GDEE QRC+ALLDVGA+ESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:   16 ILEQREATIKHMSNAITEQAVWHKNVVPTYNTALTAYLTLKWSVLVVRHGINNGSKESWLELPKLIEAQTNLSAAALASAEKKLSEKVYTLFTHEWKLVPAIEEKYIEVLMKLEASNGVIVLASLLTRYLVETKKDDLIDKLKPSMIEALIKVSISCKKKPELYVVDAAASLLKRVSHEEFKNLLLPALQKAMLRNPEIIIESVGRILSGMSLDLSQYSQDISKGLFANLHSKEDLVRDEAADACRRLALQCSDSTALENLLSSLFAVFHGSEGKLTVATHKISVLQGAGNLSYNVVSGSNIQKLTETACSHFIKVLETEVHEKTLIHALEMMSLWCKKFANDIPKSVIDAFKKGMAAKTSTAGVRTAYIKLLSWTPITSHSAMIAPILTQAITRATTQSAQPAAVTEGLLATYLLLKLVLAGQVENDKQSILWNAVDDQLFFSEKFLSTCGDDILYYLMLLCERLVTEFSDRLNEKALGGIYRAIVACVTAPKSSIRRKCAPVLKKMLTGLNSYELVEALLLEFNKFLETAKIRVDSEKESKEE-TSSGEVSGRSLADGLMAICSGSFLFEVPSMQITRDALIPAHHPTIFRAVPNLWFKIARNFGLVPKDFLRTFGSEIKKLFLNNYKPVPSYENALASVISLAPDVILPSLISNVTGKLDDPEILRVTKDEYFTYLTPEGELYDKSVIPGNDENDILNAMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEEALKAQTAKESGIRKRLAELNAKITDAVSMINAAARGNSFELGLHLKDLLHPILKDLGSPLAAPTMLQLYISLRKTVKISNNNTLSDLIAHVTLRQLQPQCDLDQAWEEEPLDEAVKRTLALIHTYTIRQKVLFTAPTFCYIFAFIKKTLLSCKDDGMITQGLQIVQEHAKQRGDISISKDARHPKLLPRKQMFDLLIELMSTTTGRVQSQAVATLLDVAQSGSGLPNCALATGEDIDSLTGALQNSLPAVRDAALRGLMIIRLAFPSEKEDYNQLLRLTRRIWVAKFDICEENKHLAEELWTAAGLVANPDILCEELIQDIAHPVEPIQQAAACALAQLLTDDPQLMPAILDRLLELYQDKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETIHRLVQFFVSTGLGDRNHAVRTEMLTAAVAAVDLHGKANITSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGLLARHLEKDDPRIKPIVLRLISALSTPSQQVQEAVANCLPHLVPSIKDDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRTATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPKTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSEQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQAEAENTLDGLRQVMAIKSRVVLPYLVPQLTSPPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEVQELEYCQAVILSVTDEVGVRTVMDQLMEATRAEDASRRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDDDKDVLQMSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGHELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIRLTSAAALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHIGIKTADDPTIRETMLQALRGVLTPAGDKMTEPMRKQVFATLSNMLGYSEDVTRNAVAGCYGALLRWLTPEQLAAAFNDNLLCNDVNADWMLRHGRSAALFVVLKESPGTVYTGKEKERVCKVILSYLAADRVQIAMNGVRACGYLFQYLMNDGQPIPQQILTPFVRSMNHTNNDVKQLLARVCTHLARNIPSEKMSPELLKALLPMLVNGTKEKNGYVKANSELALIAVLRLKHGDEEHQRCIALLDVGAKESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2588          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|951540858|ref|XP_014473386.1| (PREDICTED: translational activator GCN1 isoform X1 [Dinoponera quadriceps])

HSP 1 Score: 4087.0 bits (10598), Expect = 0.000e+0
Identity = 2159/2650 (81.47%), Postives = 2388/2650 (90.11%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MAD EL +ALKDLPNR+QTA KKERRE+ +NV+NVLSNP IN+KI+ G+CK+ S+TLHRYKD+ASQSYV+ LIV ++K+ PE  +KH+ AVITEQA WHKNVV T NT+L+AY+ALKWSTL++ HG ++++ + +  LPK+IEAQANLSAAAVAS D++L++KVY+LL+H+W    N +  Y++ L+ LE  NG I+LASL TKYL+++    L +  KV ++D FIKVAISCKKKP LYVV+ A P LRRLTH++FK+QLLPALQK+MLRNPEIII+SVGHIL+GLSLDLS+Y +EISKGLFANLHSKEDSVR+ A  ACR+LALQCSDT ALE LL+S+FAVFHGSEGKLT+ THKISVLQGAGNLS NAASG+ VQ +AE AC HF+KVLETEVHEKTLIHALEMM LW  KF + VPKSV++ FKKGMAAK+STA VRTAYIKL  S    S++  ++P L+QAI+RAMQQ AQP  VTEGLVA++LLLK V+A +VENDKQ+VLW+AIDEQIFF EKFLSTC DDILY+LM  CE+L+ E++DRLNEKAL+GVHRAIV+C TAP S+TR+RC PL KK++TGL TY PAQALL EF+KFLEN +I  E D+E+++E    GE+TGR LADGL A+CSGSFLF+ PA+++  D+L+P+HHPA+LKAVPNLW KI KN+ L P+DFL     +V+ M + NYR   +YENAL  +VSL PD  L ALV+NVTSKLDDPEILRV+KDEYFTYLTP+GELYDKSV+P NDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEE LK+QIA+EN IR+RL E ++KI  AVS++  +I G++   S YLKDLL  ILKNL SPLAAP M++L++ L + V I     +  L+AHVTLRQL+PQCDL+ AW+EEDL+  V RTLNL+H  T+++K+L  A AFCY+FPFV KTLLT+KDE +I +GLQ++QEHAKQRG+  + +DPRHPRLLPRKQMFDLLIELM  T  R+QSHAVAT LDVA SGSG    A A+ ++IDSL+GALQN+L  VRDAALR LM+++ AFPS KED +QL RLTRRVWIA+FD SDENK+LA+ELW  +  AA  E+LC+ELIQD+AHPVE VQQAAA A+AQ L + P L P +LD+LL+LYQEKLAMIPPKLNDFGRV+EQPIDTWGPRRGVALALAQ+APLLT +TI+RLV+FFVSTGLGDRN SVRTEML AAVAAVD HGK N+TSLLPVFE FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP+IVDNLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVR+ATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX    GESSFEDLLPWLMQTLTSE+SSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GLQS+QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPD +EAENTLDGLRQVMAIKSRVVLPYLVPQL S PVNTKALSILASVAGEALTRFLH+ILPALLTALSSAQGT NE QELEYCQAV+LS+TDEVGVRTVMDQLM+AT+A+D+S+RRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDEDK+VLQ SWEALTAVTKTL S+QQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+P+AKE AAQGLGEVI+L+SA+ALQPSVV ITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMT+PM+KQVF TLSSML HP+DVTR AVAGC+GALLRWLSPEQLA AFN++LLCND +ADWMLRHGRSAALFV LKESP T+Y   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM E  P+P  IL+PFVRSMNNNSNDVKQLLARVC H+ARNI P KMSPELL++L+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADVELAKALKDLPNRVQTASKKERREVLQNVVNVLSNPGINEKIVNGVCKVLSLTLHRYKDSASQSYVRNLIVELLKKQPEATVKHMTAVITEQATWHKNVVATLNTSLTAYIALKWSTLVILHGYNEETDTTQ-TLPKLIEAQANLSAAAVASTDERLSNKVYTLLAHEWTSIKNIEIIYMENLTKLEVGNGTIILASLLTKYLVASKWNDLVERLKVNMIDVFIKVAISCKKKPDLYVVDVAVPLLRRLTHEEFKNQLLPALQKAMLRNPEIIIESVGHILNGLSLDLSQYCQEISKGLFANLHSKEDSVRDNAVGACRKLALQCSDTTALETLLSSVFAVFHGSEGKLTVATHKISVLQGAGNLSYNAASGNSVQKLAETACEHFVKVLETEVHEKTLIHALEMMALWSKKFSSNVPKSVVDAFKKGMAAKTSTAAVRTAYIKLFFSTPATSYAEVIAPTLAQAISRAMQQCAQPTAVTEGLVASYLLLKFVLADQVENDKQSVLWSAIDEQIFFSEKFLSTCGDDILYHLMLLCERLVGEFSDRLNEKALNGVHRAIVSCATAPNSTTRQRCYPLVKKVVTGLSTYAPAQALLAEFSKFLENVKIKSETDKESREES-SMGEITGRCLADGLFALCSGSFLFDVPAMQMTRDALLPSHHPALLKAVPNLWYKIAKNYGLMPKDFLRSYSSEVRKMLVQNYRPVANYENALVRVVSLAPDAFLPALVSNVTSKLDDPEILRVSKDEYFTYLTPEGELYDKSVLPVNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEEVLKAQIAKENGIRRRLTELKAKIDTAVSLVTCSIRGNRQELSLYLKDLLPSILKNLGSPLAAPEMAELFLSLRQTVTIDNSAILGDLIAHVTLRQLQPQCDLDPAWEEEDLDVTVKRTLNLIHTVTIKRKELFTASAFCYVFPFVRKTLLTYKDEGMIVQGLQLIQEHAKQRGSTGELKDPRHPRLLPRKQMFDLLIELMEKTTSRVQSHAVATLLDVAHSGSGQPGTAIATSEDIDSLIGALQNSLSTVRDAALRGLMVIRQAFPSHKEDQDQLDRLTRRVWIARFDVSDENKILANELWNEAELAAQAEVLCDELIQDIAHPVEPVQQAAAYALAQCLATVPHLTPSVLDNLLQLYQEKLAMIPPKLNDFGRVIEQPIDTWGPRRGVALALAQVAPLLTADTIHRLVQFFVSTGLGDRNQSVRTEMLTAAVAAVDLHGKVNVTSLLPVFEEFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPKIVDNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRSATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESSFEDLLPWLMQTLTSESSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLQSDQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDPAEAENTLDGLRQVMAIKSRVVLPYLVPQLASPPVNTKALSILASVAGEALTRFLHRILPALLTALSSAQGTANELQELEYCQAVVLSVTDEVGVRTVMDQLMEATRAEDLSKRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDKDVLQMSWEALTAVTKTLSSEQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPDAKEHAAQGLGEVIRLSSASALQPSVVQITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTDPMKKQVFATLSSMLSHPEDVTRNAVAGCFGALLRWLSPEQLAIAFNDHLLCNDVSADWMLRHGRSAALFVALKESPGTVYNPKEKDRVCAVILSYLAADRVQIVMNGVRACGYLFQYLMNEAQPVPQQILSPFVRSMNNNSNDVKQLLARVCIHLARNILPEKMSPELLRSLLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2648          
BLAST of g72.t1 vs. GenBank_protein
Match: gi|307213548|gb|EFN88957.1| (Translational activator GCN1 [Harpegnathos saltator])

HSP 1 Score: 4085.8 bits (10595), Expect = 0.000e+0
Identity = 2165/2659 (81.42%), Postives = 2386/2659 (89.73%), Query Frame = 0
Query:    1 MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGICKIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHKNVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSAAAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLASLFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLRRLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISKGLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEGKLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEKTLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIMSVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGEVENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRLNEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLEFNKFLENARI-YEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPALRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMFIDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEYFTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAVSMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVEITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTVRQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPNDFEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTADCATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLRLTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVESVQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVEQPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTEMLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGSLARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPRIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFMDRSTETRKMAAQIIGNMYSLTDQKDLTPYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRGMGESSFEDLLPWLMQTLTSETSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSNQADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAAAKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKSRVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSAQGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAATLLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTK---------TLGSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSNLIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPMRKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCNDANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQIAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVCTHIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLKQGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2650
            MADAEL +ALKDLPNR+QTA KKERRE+ +NV+NVLSNP IN+KI+ G+CK+ S+TLHRYKD+ASQSYV+ LIV ++K+ P+  +KH+ AV+TEQA WHKNVV T NT+L+AY+ALKWSTL++ HG +++  + +  LPK+IEAQANLSAAAVAS D++L++KVY+LL+H+W    N +  Y++ L+ LE  NG I+LASL TKYL+++ +  L +  KV ++D FIKV ISCKKKP LYVV+ A P LRRLTH++FK  LLPALQK+MLRNPEIII+SVGHIL+GLSLDLS+Y +EISKGLFANLHSKED VR+ A  ACR+LALQCSDT ALE LL+S+FAVFHGSEGKLT+ THKISVLQGAGNLS NAASGS VQ +AE AC HF+KVLETEVHEKTLIHALEMM LW  KF + VPKSV++ FKKGMAAK+STA VRTAYIKL  S    S++  ++P L+QAI+RAMQQ AQP  VTEGLVA++LLLK V+A +VENDKQ+VLW+AIDEQIFF EKFLSTC DDILY+LM  CE+LI E++DRLNEKAL+GVHRAIV+C TAP SSTR+RC PL KK++TGL TY PAQALL EFNKFLEN +I  E D+E++DE    GE+TGR LADGL A+CSGSFLF+ PA+++  DSL+P+HHPA+LKAVPNLW KI KN+   P+DFL     +V+ M I NYR   +YENAL  +VSL PD  L ALV+NV SKLDDPEILRVTKDEYFTYLTP+GELYDKSV+P NDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLT KQEE LK+QIA+EN IRKRL E ++KI  AVS++  +I G++   S +LKDLL  ILKNL SPLAAP M++LY+ L + V I     +  L+AHVTLRQL+PQCDL+ AW+EE+L+ AV RTLNL+H  T+++K+L  A AFCY+FPFV KTLLT+KD+ +I +GLQ +QEH KQRG+ N+ +DPRHPRLLPRKQMFDLLIELM  T GR+QSHAVAT LDVA SGSG  + A A+ ++IDSL+GALQN+L  VRDAALR L +++ AFPS KED +QL RLTRRVWIA+FD SDENK+LA+ELW+A+   A  E+LC+ELIQD+AHPVE VQQAAA A+AQ L + P L P +LD+LL+LYQEKLAMIPPKLNDFGRV+EQPIDTWGPRRGVALALAQ+APLLT +TI+RLV+FFVSTGLGDRN SVRTEML AAVAAVD HGK N+TSLLPVFE+FMDKAPKIGSFDSIKQSVVILMGSLARHL+KDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP+IVDNLMDQLLKSDKYGERKGAAYGLAG+IKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPS KTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAF+DRSTETRKMAAQIIGNMYSLTDQKDLTP   XXXXXXXXXXXXXXXXXXXXXXXXXXXX    GESSFEDLLPWLMQTLTSE+SSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFT EFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYAD+AIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLY ISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERR+RVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLF+LLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILE+GLQS+QADQRQGVCIGLSEIMAST+KDMVLTFV SLVPTVRKALCDPLPEVRQAAAKTFD LHSTVGVRALDDILPAMLTQLNSPD +EAENTLDGLRQVMAIKSRVVLPYLVPQL S PVNTKALSILASVAGEALTRFLH+ILPALLTALSSAQGT NE QELEYCQAV+LS+TDEVGVRTVMDQLM+AT+A+D+S+RRSAATLLCAFCRDTRADYSQYVPQLLRGL+HLFTDEDK+VLQ SWEALTAVTK         TL S+QQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNG+PEAKE AAQGLGEVI+L+SA+ALQPSVV ITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFL+ALNDSNRQVRLKAAYALSNLIVIHTR DPLF ELHTGIKT DD AIRETMLQALRGVLTPAGDKMT+PM+KQVF TLSSML HP+DVTR AVAGC+GALLRWLSPEQLA  FN++LLCND NADWMLRHGRSAALFV LKESPAT+Y   E++R C VILSYLAADRVQI MNGVRACGYLFQYLM E  P+P  IL+PFVRSMNNNSNDVKQLLARVC H+ARNI P KMSPELL+AL+PMLVNGTKEKNGYVKANSELALIAVLRL+QG+EE QRCMA LD GARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
Sbjct:    1 MADAELAKALKDLPNRVQTASKKERREVLQNVVNVLSNPGINEKIVNGVCKVLSLTLHRYKDSASQSYVRNLIVELLKKQPDATVKHMTAVVTEQATWHKNVVATLNTSLTAYIALKWSTLVILHGYNEEMDTTQ-ILPKLIEAQANLSAAAVASNDERLSNKVYTLLAHEWTTIKNIEIIYVENLTKLEIGNGTIILASLLTKYLVASKRNDLVEQLKVNMIDIFIKVTISCKKKPDLYVVDVAVPLLRRLTHEEFKIHLLPALQKAMLRNPEIIIESVGHILNGLSLDLSQYCQEISKGLFANLHSKEDLVRDNAVGACRKLALQCSDTTALESLLSSVFAVFHGSEGKLTVATHKISVLQGAGNLSYNAASGSSVQKLAETACEHFVKVLETEVHEKTLIHALEMMALWSKKFSSNVPKSVVDAFKKGMAAKTSTAAVRTAYIKLFFSTPATSYAGVIAPTLAQAISRAMQQCAQPTAVTEGLVASYLLLKFVLADQVENDKQSVLWSAIDEQIFFSEKFLSTCGDDILYHLMLLCERLISEFSDRLNEKALNGVHRAIVSCATAPNSSTRQRCFPLVKKVVTGLSTYAPAQALLTEFNKFLENVKIKSEADKESRDES-SMGEITGRCLADGLFALCSGSFLFDVPAMQMTRDSLLPSHHPALLKAVPNLWFKIAKNYSFIPKDFLRSYSSEVRKMLIQNYRPLANYENALIKVVSLAPDAFLPALVSNVISKLDDPEILRVTKDEYFTYLTPEGELYDKSVLPVNDENDILNSMNMKRESKVYSFKEQQEELQLRRELYEKRKREGKIKEPKLTPKQEETLKAQIAKENGIRKRLTELKAKIDTAVSLVTCSIRGNRQELSLHLKDLLPSILKNLGSPLAAPEMAELYLSLRQTVTIDNSAILGDLIAHVTLRQLQPQCDLDPAWEEENLDVAVKRTLNLIHTVTIKKKELFTASAFCYVFPFVRKTLLTYKDDGMIVQGLQFIQEHTKQRGSTNELKDPRHPRLLPRKQMFDLLIELMEKTTGRVQSHAVATLLDVAHSGSGQPNTAIATSEDIDSLIGALQNSLSTVRDAALRGLAVIRQAFPSHKEDEDQLDRLTRRVWIARFDVSDENKILANELWDAAELTARAEVLCDELIQDIAHPVEPVQQAAAYALAQCLATVPHLTPSVLDNLLQLYQEKLAMIPPKLNDFGRVIEQPIDTWGPRRGVALALAQIAPLLTADTIHRLVQFFVSTGLGDRNQSVRTEMLTAAVAAVDLHGKVNVTSLLPVFEDFMDKAPKIGSFDSIKQSVVILMGSLARHLDKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAPKIVDNLMDQLLKSDKYGERKGAAYGLAGIIKGMGILALKQLDIMTTLTNAIQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYVRAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMAYCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQAIVPVLLKALQDPSHKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFLDRSTETRKMAAQIIGNMYSLTDQKDLTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESSFEDLLPWLMQTLTSESSSVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERTDIAPHVKDGYIMMFIYMPSAFTTEFTPYIGQIINPILKALADENEYVRETALRAGQRIVTLYADSAIMLLLPELEKGLFDDNWRIRYSSVQLLGDLLYRISGVSGKMSTETASEDDNFGTEQSHYAIINALGAERRNRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPTLFTLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILEKGLQSDQADQRQGVCIGLSEIMASTNKDMVLTFVISLVPTVRKALCDPLPEVRQAAAKTFDGLHSTVGVRALDDILPAMLTQLNSPDSAEAENTLDGLRQVMAIKSRVVLPYLVPQLASPPVNTKALSILASVAGEALTRFLHRILPALLTALSSAQGTANELQELEYCQAVVLSVTDEVGVRTVMDQLMEATRAEDLSKRRSAATLLCAFCRDTRADYSQYVPQLLRGLIHLFTDEDKDVLQMSWEALTAVTKASILCSHRATLSSEQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAILNGLPEAKEHAAQGLGEVIRLSSASALQPSVVQITGPLIRILGDRFNWSVKAAVLETLAILLGKVGVMLKQFLPQLQTTFLRALNDSNRQVRLKAAYALSNLIVIHTRVDPLFTELHTGIKTGDDPAIRETMLQALRGVLTPAGDKMTDPMKKQVFATLSSMLSHPEDVTRNAVAGCFGALLRWLSPEQLAITFNDHLLCNDVNADWMLRHGRSAALFVTLKESPATVYNPKEKDRVCTVILSYLAADRVQIVMNGVRACGYLFQYLMNEAQPVPQQILSPFVRSMNNNSNDVKQLLARVCIHLARNILPEKMSPELLRALLPMLVNGTKEKNGYVKANSELALIAVLRLRQGEEEHQRCMAFLDAGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT 2657          
The following BLAST results are available for this feature:
BLAST of g72.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1000717785|ref|XP_015595612.1|0.000e+084.00eIF-2-alpha kinase activator GCN1 isoform X1 [Ceph... [more]
gi|817194901|ref|XP_012272971.1|0.000e+083.47eIF-2-alpha kinase activator GCN1 [Orussus abietin... [more]
gi|954548895|ref|XP_014597750.1|0.000e+082.38PREDICTED: translational activator GCN1 [Polistes ... [more]
gi|972201909|ref|XP_015183054.1|0.000e+082.34PREDICTED: translational activator GCN1 [Polistes ... [more]
gi|749734041|ref|XP_011149210.1|0.000e+081.70eIF-2-alpha kinase activator GCN1 [Harpegnathos sa... [more]
gi|769834005|ref|XP_011647093.1|0.000e+081.93eIF-2-alpha kinase activator GCN1 [Pogonomyrmex ba... [more]
gi|805778182|ref|XP_012138451.1|0.000e+082.08PREDICTED: translational activator GCN1 isoform X2... [more]
gi|1389706728|ref|XP_024940665.1|0.000e+084.11eIF-2-alpha kinase activator GCN1 isoform X2 [Ceph... [more]
gi|951540858|ref|XP_014473386.1|0.000e+081.47PREDICTED: translational activator GCN1 isoform X1... [more]
gi|307213548|gb|EFN88957.1|0.000e+081.42Translational activator GCN1 [Harpegnathos saltato... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0033554 cellular response to stress
biological_process GO:0033674 positive regulation of kinase activity
biological_process GO:0045859 regulation of protein kinase activity
biological_process GO:0006417 regulation of translation
molecular_function GO:0019901 protein kinase binding
molecular_function GO:0019887 protein kinase regulator activity
molecular_function GO:0043022 ribosome binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034085TOG domainSMARTSM01349TOG_3coord: 1340..1573
e-value: 3.6E-33
score: 126.2
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 1858..2036
e-value: 3.9E-27
score: 97.3
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 2062..2224
e-value: 2.2E-10
score: 42.5
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 2232..2437
e-value: 1.8E-18
score: 67.9
IPR011989Armadillo-like helicalGENE3D1.25.10.10coord: 1667..1822
e-value: 8.3E-17
score: 63.5
coord: 1343..1666
e-value: 1.6E-134
score: 450.4
NoneNo IPR availablePFAMPF13513HEAT_EZcoord: 2297..2351
e-value: 1.1E-5
score: 25.8
NoneNo IPR availablePANTHERPTHR23346TRANSLATIONAL ACTIVATOR GCN1-RELATEDcoord: 131..2632
IPR033173Translational activator Gcn1PANTHERPTHR23346:SF7EIF-2-ALPHA KINASE ACTIVATOR GCN1coord: 131..2632
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 1981..2018
score: 10.545
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 1514..1551
score: 10.096
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 1633..1671
score: 10.321
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 964..1358
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 1875..2586
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 66..1082
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 1288..2034

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:539132..547864 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g72.t1g72.t1Venturia canescensmRNAscaffold_1 539132..547864 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g72.t1-PA ID=g72.t1-PA|Name=g72.t1|organism=Venturia canescens|type=polypeptide|length=2649bp
MADAELTRALKDLPNRIQTAGKKERREIFENVINVLSNPAINDKILGGIC
KIASITLHRYKDTASQSYVKGLIVAMIKQHPETVIKHLAAVITEQAVWHK
NVVPTKNTALSAYLALKWSTLLVQHGASKDSQSLKDELPKVIEAQANLSA
AAVASMDKKLNDKVYSLLSHQWKVSANSDERYLDVLSNLEASNGVIVLAS
LFTKYLISNDKEKLADTFKVKILDSFIKVAISCKKKPQLYVVEAAEPFLR
RLTHDDFKDQLLPALQKSMLRNPEIIIDSVGHILSGLSLDLSRYSEEISK
GLFANLHSKEDSVREAAAEACRRLALQCSDTAALEKLLASLFAVFHGSEG
KLTMVTHKISVLQGAGNLSQNAASGSGVQTVAEVACGHFIKVLETEVHEK
TLIHALEMMTLWCAKFVNQVPKSVIETFKKGMAAKSSTAGVRTAYIKLIM
SVNVISHSATLSPILSQAITRAMQQAAQPPVVTEGLVAAHLLLKLVIAGE
VENDKQNVLWNAIDEQIFFGEKFLSTCSDDILYNLMQFCEKLIVEYADRL
NEKALSGVHRAIVACVTAPKSSTRRRCAPLAKKLLTGLGTYEPAQALLLE
FNKFLENARIYEGDRENKDEGPPSGEVTGRSLADGLLAVCSGSFLFEQPA
LRLVTDSLIPAHHPAILKAVPNLWSKIVKNFDLAPRDFLVRCLGDVKTMF
IDNYRATPSYENALGTIVSLTPDLVLGALVANVTSKLDDPEILRVTKDEY
FTYLTPDGELYDKSVIPGNDENDILNSMNMKRESKVYSFKEQQEELQLRR
ELYEKRKREGKIKEPKLTAKQEEALKSQIARENAIRKRLREFQSKITLAV
SMMKAAILGDKFHSSFYLKDLLAPILKNLVSPLAAPTMSQLYIELGKIVE
ITKDRTMSSLVAHVTLRQLEPQCDLEAAWQEEDLEKAVSRTLNLLHNYTV
RQKQLLIAPAFCYIFPFVMKTLLTWKDESIISEGLQIVQEHAKQRGAPND
FEDPRHPRLLPRKQMFDLLIELMSSTAGRIQSHAVATFLDVARSGSGTAD
CATASGDEIDSLMGALQNNLPAVRDAALRALMIVKLAFPSEKEDYEQLLR
LTRRVWIAKFDTSDENKVLADELWEASGFAASPEILCEELIQDVAHPVES
VQQAAALAMAQLLKSAPELMPGILDSLLELYQEKLAMIPPKLNDFGRVVE
QPIDTWGPRRGVALALAQLAPLLTPETINRLVEFFVSTGLGDRNTSVRTE
MLVAAVAAVDYHGKANITSLLPVFENFMDKAPKIGSFDSIKQSVVILMGS
LARHLEKDDPRIKPIVMRLIAALSTPSQQVQEAVANCLPHLVPSIKEDAP
RIVDNLMDQLLKSDKYGERKGAAYGLAGLIKGMGILALKQLDIMTTLTNA
IQDKKNYRHREGALFAFEMLCTMLGRLFEPYIVHVLPHLLLCFGDSSQYV
RAATDDTARVVMSKLSAHGVKLVLPSLLAALEEDSWRTKTGSVELLGAMA
YCAPKQLSSCLPSIVPKLIEVLSDSHTKVQEAGAEALKVIGSVIRNPEIQ
AIVPVLLKALQDPSRKTATCLQTLLDTQFVHFIDAPSLALIMPVVQRAFM
DRSTETRKMAAQIIGNMYSLTDQKDLTPYLPTIIPGLKTSLLDPVPEVRS
VSARALGAMVRGMGESSFEDLLPWLMQTLTSETSSVDRSGAAQGLSEVVR
GLGVEKLHKLMPEIISTAERTDIAPHVKDGYIMMFIYMPSAFTREFTPYI
GQIINPILKALADENEYVRETALRAGQRIVTLYADTAIMLLLPELEKGLF
DDNWRIRYSSVQLLGDLLYHISGVSGKMSTETASEDDNFGTEQSHYAIIN
ALGAERRHRVLAGLYMGRSDVALMVRQAALHVWKVVVTNTPRTLREILPT
LFSLLLGCLASTSYDKRQVAARTLGDLVRKLGERVLPEIIPILERGLQSN
QADQRQGVCIGLSEIMASTSKDMVLTFVNSLVPTVRKALCDPLPEVRQAA
AKTFDSLHSTVGVRALDDILPAMLTQLNSPDQSEAENTLDGLRQVMAIKS
RVVLPYLVPQLTSQPVNTKALSILASVAGEALTRFLHKILPALLTALSSA
QGTPNEAQELEYCQAVILSITDEVGVRTVMDQLMDATKADDVSRRRSAAT
LLCAFCRDTRADYSQYVPQLLRGLLHLFTDEDKEVLQKSWEALTAVTKTL
GSDQQIAHVQDIRQAVRFAVSDLKGQELLPGFCLPKGITPILPIFREAIL
NGMPEAKEQAAQGLGEVIKLTSANALQPSVVHITGPLIRILGDRFNWSVK
AAVLETLAILLGKVGVMLKQFLPQLQTTFLKALNDSNRQVRLKAAYALSN
LIVIHTRADPLFAELHTGIKTSDDSAIRETMLQALRGVLTPAGDKMTEPM
RKQVFVTLSSMLGHPDDVTRTAVAGCYGALLRWLSPEQLANAFNENLLCN
DANADWMLRHGRSAALFVVLKESPATIYAANEEERACKVILSYLAADRVQ
IAMNGVRACGYLFQYLMMENLPIPIVILTPFVRSMNNNSNDVKQLLARVC
THIARNIPPSKMSPELLKALIPMLVNGTKEKNGYVKANSELALIAVLRLK
QGDEEQQRCMALLDVGARESLSDVVSKVLRKVLSQPEGKIEELDDTLLT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0045859regulation of protein kinase activity
GO:0006417regulation of translation
GO:0033554cellular response to stress
GO:0033674positive regulation of kinase activity
Vocabulary: Molecular Function
TermDefinition
GO:0043022ribosome binding
GO:0019901protein kinase binding
GO:0019887protein kinase regulator activity
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR011989ARM-like
IPR033173Gcn1
IPR021133HEAT_type_2
IPR016024ARM-type_fold