g76.t1-PA (polypeptide) Venturia canescens

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
Nameg76.t1
Unique Nameg76.t1-PA
Typepolypeptide
OrganismVenturia canescens (vcanescens)
Sequence length415
Homology
BLAST of g76.t1 vs. GenBank_protein
Match: gi|1000717797|ref|XP_015595681.1| (T-box-containing protein TBX6L isoform X1 [Cephus cinctus] >gi|1389706661|ref|XP_024940422.1| T-box-containing protein TBX6L isoform X1 [Cephus cinctus] >gi|1389706664|ref|XP_024940430.1| T-box-containing protein TBX6L isoform X1 [Cephus cinctus])

HSP 1 Score: 427.9 bits (1099), Expect = 4.600e-116
Identity = 255/406 (62.81%), Postives = 281/406 (69.21%), Query Frame = 0
Query:   10 NGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAEDRSACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPLRTQENERRSESAQQPARLHRPWADSSSPTQHIHHRVQESPLAAPSATHPALDFHLFNPFLLPSSHQHHLAALEIARFQHQMQQHRY-ASQHLAKFY 415
            +GWLV P PG GP LP  V +ELQN++LW+QFHAE+TEMIITKLGRRMFP+VQL + GLE RARYCLLLE+APASRRRHKYVG  GEN   P   RGWTSAGPAEPQPRINRRVYLHPDSPATG HWMQHPVSF KLKLTNNAVDHHNNVVLTSMHKYIP+IW+IRCDD  ++NNLYSQP++SFTFDETEFIAVTAYQNENITKLKI+NNPFAKGFRETGQSRCKRKLH +   S  S  D    XXXXXXXXXXXXXXXXX                                             +P    EN   +       RLHRPW+DS  P Q      +  PL AP  TH    F L +PF+ PS   HHL ALE AR  HQM  HRY A+ +L+KFY
Sbjct:   37 SGWLVSPCPGGGPPLPREVTVELQNRRLWQQFHAETTEMIITKLGRRMFPSVQLVIRGLERRARYCLLLEVAPASRRRHKYVGGGGENGGNP-CARGWTSAGPAEPQPRINRRVYLHPDSPATGAHWMQHPVSFSKLKLTNNAVDHHNNVVLTSMHKYIPKIWVIRCDDATSLNNLYSQPASSFTFDETEFIAVTAYQNENITKLKIDNNPFAKGFRETGQSRCKRKLHHVT--SSDSGLDXXXXXXXXXXXXXXXXXXXXXSNRIQRPSECEGQRLKRAFSETGSFDDSGVSSSGGASPPLPSASINPCPRIENHNPT------PRLHRPWSDSPPPVQ---QTPEPKPLHAPLPTH----FQLLHPFVFPS---HHLTALEFARI-HQM--HRYQAAGYLSKFY 420          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|817193897|ref|XP_012272430.1| (T-box transcription factor TBX6-like [Orussus abietinus])

HSP 1 Score: 410.2 bits (1053), Expect = 9.900e-111
Identity = 234/413 (56.66%), Postives = 260/413 (62.95%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQM-NERSESSAEDRSACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPLRTQENERRSESAQQPARLHRPWADSSSPTQHIHHRVQESPLAAPSATHPALDFHLFNPFLLPSSHQHHLAALEIARFQHQMQQHR-YASQHLAKFY 415
            EE+   +GW VPPSPGAGPSLP  VK+EL NK+LW+QFHAE+TEMIITKLGRRMFP+VQL VSGL+ RARYCLLLE+APAS RRHKYVG +G    +    RGWTSAGPAEPQPRINRRVYLHPDSPA+G HWMQHP+SF KLKLTNNAVDHHNNVVL SMHKYIP+IWIIRCDDL +MNNL SQP+ASF F+ETEFIAVTAYQNENITKLKI+NNPFAKGFRETGQSRCKRKLH + +E S +  E RS                                                                SP  T EN +         RLHRPWA              +              F LFNPFL+P   QHH AALE+AR Q   Q HR Y    + KFY
Sbjct:   32 EEMPAPSGWFVPPSPGAGPSLPRDVKVELHNKELWQQFHAETTEMIITKLGRRMFPSVQLLVSGLDRRARYCLLLEVAPASPRRHKYVGGAGGVDGS--GARGWTSAGPAEPQPRINRRVYLHPDSPASGAHWMQHPISFSKLKLTNNAVDHHNNVVLASMHKYIPKIWIIRCDDLNSMNNLSSQPAASFYFNETEFIAVTAYQNENITKLKIDNNPFAKGFRETGQSRCKRKLHHLTSEDSNTGCEVRSPLDDEEGNVSSSESESNRTSSSHDGQIVEQRTKRALSEAGSLDDSGVSSSDGASPPLPSVNFHPSP--TVENNQNPR-----PRLHRPWAXXXXXXXXXXXXXHQ-------------QFPLFNPFLMP---QHHFAALELARIQ---QIHRYYPGPLMTKFY 416          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|987906995|ref|XP_015429003.1| (PREDICTED: T-box transcription factor TBX3-like [Dufourea novaeangliae])

HSP 1 Score: 376.7 bits (966), Expect = 1.200e-100
Identity = 181/249 (72.69%), Postives = 205/249 (82.33%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTP--GTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED 251
            E+I + N W + P+PG GP LP  VK+ELQN++LWRQFHAE+TEMIITKLGRRMFP++QL VSGLE RARYC+LLE+ PAS RRHKYVG  G +      G  RGWTSAGPAEPQPRI+RR+YLHPDSPATG HWMQHP++F KLKLTNNAVD   NVVLTSMHKYIPRIWIIRCDD+  +++LYS P++SF F ETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRK  Q    +    ED
Sbjct:   34 EDIPNPNTWSI-PTPGGGPPLPPEVKVELQNRELWRQFHAETTEMIITKLGRRMFPSIQLTVSGLERRARYCVLLEVEPASDRRHKYVGGGGGSGVEDGCGNARGWTSAGPAEPQPRIDRRIYLHPDSPATGAHWMQHPLNFNKLKLTNNAVDPRTNVVLTSMHKYIPRIWIIRCDDVTRLSDLYSHPASSFKFKETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKFQQTEGETSCRIED 281          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|1016160439|gb|KZC07601.1| (T-box transcription factor TBX2, partial [Dufourea novaeangliae])

HSP 1 Score: 376.7 bits (966), Expect = 1.200e-100
Identity = 181/249 (72.69%), Postives = 205/249 (82.33%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTP--GTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED 251
            E+I + N W + P+PG GP LP  VK+ELQN++LWRQFHAE+TEMIITKLGRRMFP++QL VSGLE RARYC+LLE+ PAS RRHKYVG  G +      G  RGWTSAGPAEPQPRI+RR+YLHPDSPATG HWMQHP++F KLKLTNNAVD   NVVLTSMHKYIPRIWIIRCDD+  +++LYS P++SF F ETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRK  Q    +    ED
Sbjct:    2 EDIPNPNTWSI-PTPGGGPPLPPEVKVELQNRELWRQFHAETTEMIITKLGRRMFPSIQLTVSGLERRARYCVLLEVEPASDRRHKYVGGGGGSGVEDGCGNARGWTSAGPAEPQPRIDRRIYLHPDSPATGAHWMQHPLNFNKLKLTNNAVDPRTNVVLTSMHKYIPRIWIIRCDDVTRLSDLYSHPASSFKFKETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKFQQTEGETSCRIED 249          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|766922748|ref|XP_011505963.1| (PREDICTED: T-box-containing protein TBX6L-like [Ceratosolen solmsi marchali])

HSP 1 Score: 370.9 bits (951), Expect = 6.700e-99
Identity = 220/409 (53.79%), Postives = 258/409 (63.08%), Query Frame = 0
Query:    4 EEIAHTNGW-LVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAEDRSACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPLRTQENERRSESAQQPARLHRPWADSSSPTQHIHHRVQESPLAAPSATHPALDFHLFNPFLLPSSHQH-HLAALEIARFQHQMQQHRYASQHL 411
            +EI +TNGW  +  +P AGP LP  VK++L+NKKLW+QFHAESTEMIITK GRRMFP+VQL+VSGLE R+RYC+LLE+APAS RRHKYVG S     TP   RGWTSAGPAEPQP + RR+Y+HPDSPA+G HWMQHP+ F KLKLTNN V+HH+NV+LTSMHKYIPRIWIIRCDD+ +M +LY+ PS+ FTF ETEFIAVTAYQNENITKLKI+NNPFAKGFRE+GQS CKRK  +       S+    +        XXXXXXXXX                                               PLRT+   RR     QP RLHRPW D       I       P   PS   P L  H  +P  L     H HL AL++AR +H  Q+   A+QHL
Sbjct:   34 DEITNTNGWSAMLNAPTAGPQLPDDVKVQLENKKLWQQFHAESTEMIITKSGRRMFPSVQLSVSGLERRSRYCVLLELAPASDRRHKYVGGSEAGRGTP---RGWTSAGPAEPQPPVERRLYMHPDSPASGSHWMQHPLGFSKLKLTNNVVEHHSNVLLTSMHKYIPRIWIIRCDDVTSMRDLYNNPSSCFTFRETEFIAVTAYQNENITKLKIDNNPFAKGFRESGQSACKRKRQRPPHEDTGSSNSEISHDEEEGNVXXXXXXXXXHEAPLTKRSRHRETEENCCSVASTESKRNPTPPPVV-----------PLRTEAVPRRE---TQP-RLHRPWTDDGEEVTRIR------PSGNPS--QPPLHQHHHHPDYLGVQQAHYHLVALDLARMRHMQQRFAVAAQHL 416          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|1026571248|gb|OAD58738.1| (T-box transcription factor TBX6, partial [Eufriesea mexicana])

HSP 1 Score: 369.4 bits (947), Expect = 1.900e-98
Identity = 176/241 (73.03%), Postives = 201/241 (83.40%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGEN-SSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNER 244
            E+I ++N W + PS G GP LP  VK+ELQN++LW+QFHAE+TEM+ITK+GRRMFP +QL ++GLE RARYC+LLE+ PAS RRHKYVG  G     T G  RGWTSAGPAEPQPR++RR+YLHPDSPATG +WMQHP SF KLKLTNNAVD  NN+VLTSMHKYIPRIWIIRCDD   +++LYS PS+SF F ETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRK     ER
Sbjct:   34 EDIPNSNTWSI-PSLGGGPPLPSEVKVELQNRELWQQFHAETTEMVITKVGRRMFPTIQLTITGLERRARYCVLLEVEPASDRRHKYVGGGGSGLEKTCGNARGWTSAGPAEPQPRLDRRIYLHPDSPATGTYWMQHPHSFNKLKLTNNAVDPRNNLVLTSMHKYIPRIWIIRCDDATRLSDLYSHPSSSFKFPETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKFQAEAER 273          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|1059215805|ref|XP_017754696.1| (PREDICTED: T-box transcription factor TBX6-like [Eufriesea mexicana])

HSP 1 Score: 369.4 bits (947), Expect = 1.900e-98
Identity = 176/241 (73.03%), Postives = 201/241 (83.40%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGEN-SSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNER 244
            E+I ++N W + PS G GP LP  VK+ELQN++LW+QFHAE+TEM+ITK+GRRMFP +QL ++GLE RARYC+LLE+ PAS RRHKYVG  G     T G  RGWTSAGPAEPQPR++RR+YLHPDSPATG +WMQHP SF KLKLTNNAVD  NN+VLTSMHKYIPRIWIIRCDD   +++LYS PS+SF F ETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRK     ER
Sbjct:   30 EDIPNSNTWSI-PSLGGGPPLPSEVKVELQNRELWQQFHAETTEMVITKVGRRMFPTIQLTITGLERRARYCVLLEVEPASDRRHKYVGGGGSGLEKTCGNARGWTSAGPAEPQPRLDRRIYLHPDSPATGTYWMQHPHSFNKLKLTNNAVDPRNNLVLTSMHKYIPRIWIIRCDDATRLSDLYSHPSSSFKFPETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKFQAEAER 269          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|1492496346|ref|XP_017892767.2| (T-box transcription factor TBX3-like [Ceratina calcarata])

HSP 1 Score: 361.3 bits (926), Expect = 5.300e-96
Identity = 172/237 (72.57%), Postives = 199/237 (83.97%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQM 241
            E+I + + W V PS G GP L   VK+ELQN++LW+QFHAE+TEM+ITK+GRRMFP++QL+V+GLE RARYC+LLE+ PAS RRHKYVG  G  +   G  RGWTSAGPAEPQPRI+RR+YLHPDSPATG HWMQHP++F KLKLTNNA D  NNVVLTSMHKY+PRIWIIRCD+   + +LYS P++SF F ETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRK   M
Sbjct:   34 EDIPNPSAWTV-PSLGGGPPLSPDVKVELQNRELWQQFHAETTEMVITKVGRRMFPSIQLSVTGLERRARYCVLLEVEPASDRRHKYVG--GGLNKGCGNARGWTSAGPAEPQPRIDRRIYLHPDSPATGAHWMQHPLNFNKLKLTNNAADPRNNVVLTSMHKYVPRIWIIRCDEATRLTDLYSHPASSFKFRETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKFQTM 267          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|350415940|ref|XP_003490797.1| (T-box protein 2-like [Bombus impatiens])

HSP 1 Score: 358.2 bits (918), Expect = 4.500e-95
Identity = 172/247 (69.64%), Postives = 200/247 (80.97%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED 251
            E+I + N W + P  G GP LP  VKIELQN++LW+QFHAE+TEM+ITK GRRMFP++QL ++GLE RARYC+LLE+ PAS RRHKYVG+ G    T G  RGWTSAGPAEPQPRI+RR+YLHPDSPATG HWMQH + F KLKLTNNAVD  NNVVLTSMHKYIPRIWIIR DD   +++LYS P+++F F+ET+FIAVTAYQNENITKLKINNNPFAKGFR+ GQSRCKRK     ER     +D
Sbjct:   36 EDIPNPNMWTL-PCLGGGPPLPSEVKIELQNRQLWQQFHAETTEMVITKGGRRMFPSIQLAITGLEPRARYCVLLEVEPASDRRHKYVGSGGGLEKTCGNARGWTSAGPAEPQPRIDRRIYLHPDSPATGTHWMQHSLKFDKLKLTNNAVDPRNNVVLTSMHKYIPRIWIIRSDDATRLSDLYSHPASAFKFNETQFIAVTAYQNENITKLKINNNPFAKGFRDCGQSRCKRKFQSEAERLNRLDDD 281          
BLAST of g76.t1 vs. GenBank_protein
Match: gi|340710282|ref|XP_003393722.1| (T-box protein 2 [Bombus terrestris])

HSP 1 Score: 357.8 bits (917), Expect = 5.900e-95
Identity = 171/247 (69.23%), Postives = 200/247 (80.97%), Query Frame = 0
Query:    4 EEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMIITKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSSTPGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTNNAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEFIAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED 251
            E+I + N W + P  G GP LP  VKIELQN++LW+QFHAE+TEM+ITK GRRMFP++QL ++GLE RARYC+LLE+ PAS RRHKYVG+ G    T G  RGWTSAGPAEPQPRI+RR+YLHPDSPATG HWMQH + F KLKLTNNAVD  NN+VLTSMHKYIPRIWIIR DD   +++LYS P+++F F+ET+FIAVTAYQNENITKLKINNNPFAKGFR+ GQSRCKRK     ER     +D
Sbjct:   36 EDIPNPNMWTL-PCLGGGPPLPSEVKIELQNRQLWQQFHAETTEMVITKGGRRMFPSIQLAITGLEPRARYCVLLEVEPASDRRHKYVGSGGGLEKTCGNVRGWTSAGPAEPQPRIDRRIYLHPDSPATGTHWMQHSLKFDKLKLTNNAVDPRNNIVLTSMHKYIPRIWIIRSDDATRLSDLYSHPASAFKFNETQFIAVTAYQNENITKLKINNNPFAKGFRDCGQSRCKRKFQSEAERLNRLDDD 281          
The following BLAST results are available for this feature:
BLAST of g76.t1 vs. GenBank_protein
Analysis Date: 2019-06-20 (Blastp: OGS1.1 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1000717797|ref|XP_015595681.1|4.600e-11662.81T-box-containing protein TBX6L isoform X1 [Cephus ... [more]
gi|817193897|ref|XP_012272430.1|9.900e-11156.66T-box transcription factor TBX6-like [Orussus abie... [more]
gi|987906995|ref|XP_015429003.1|1.200e-10072.69PREDICTED: T-box transcription factor TBX3-like [D... [more]
gi|1016160439|gb|KZC07601.1|1.200e-10072.69T-box transcription factor TBX2, partial [Dufourea... [more]
gi|766922748|ref|XP_011505963.1|6.700e-9953.79PREDICTED: T-box-containing protein TBX6L-like [Ce... [more]
gi|1026571248|gb|OAD58738.1|1.900e-9873.03T-box transcription factor TBX6, partial [Eufriese... [more]
gi|1059215805|ref|XP_017754696.1|1.900e-9873.03PREDICTED: T-box transcription factor TBX6-like [E... [more]
gi|1492496346|ref|XP_017892767.2|5.300e-9672.57T-box transcription factor TBX3-like [Ceratina cal... [more]
gi|350415940|ref|XP_003490797.1|4.500e-9569.64T-box protein 2-like [Bombus impatiens][more]
gi|340710282|ref|XP_003393722.1|5.900e-9569.23T-box protein 2 [Bombus terrestris][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
InterPro
Analysis Name: InterProScan on OGS1.1
Date Performed: 2019-06-20
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001699Transcription factor, T-boxPRINTSPR00937TBOXcoord: 160..174
score: 56.96
coord: 198..211
score: 76.4
coord: 45..69
score: 60.87
coord: 219..227
score: 82.61
IPR001699Transcription factor, T-boxSMARTSM00425tbox5coord: 27..232
e-value: 2.6E-92
score: 322.6
IPR001699Transcription factor, T-boxPFAMPF00907T-boxcoord: 30..227
e-value: 4.9E-73
score: 245.3
IPR001699Transcription factor, T-boxPANTHERPTHR11267T-BOX PROTEIN-RELATEDcoord: 23..358
IPR001699Transcription factor, T-boxPROSITEPS50252TBOX_3coord: 32..227
score: 68.071
IPR001699Transcription factor, T-boxCDDcd00182TBOXcoord: 27..231
e-value: 1.56544E-95
score: 282.169
IPR036960T-box superfamilyGENE3D2.60.40.820coord: 21..227
e-value: 5.5E-86
score: 289.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 263..283
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..113
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 227..362
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 93..110
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 228..250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..319
NoneNo IPR availablePANTHERPTHR11267:SF51DORSOCROSS1, ISOFORM A-RELATEDcoord: 23..358
IPR018186Transcription factor, T-box, conserved sitePROSITEPS01264TBOX_2coord: 125..143
IPR018186Transcription factor, T-box, conserved sitePROSITEPS01283TBOX_1coord: 37..56
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILY49417p53-like transcription factorscoord: 28..227

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_1contigscaffold_1:557932..569526 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: OGS1.1 vs NR2019-06-20
InterProScan on OGS1.12019-06-20
Blast2GO on OGS1.12019-06-19 .181802
Venturia canescens OGS 1.1 201901312019-01-31
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
g76.t1g76.t1Venturia canescensmRNAscaffold_1 557932..569526 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>g76.t1-PA ID=g76.t1-PA|Name=g76.t1|organism=Venturia canescens|type=polypeptide|length=415bp
MVIEEIAHTNGWLVPPSPGAGPSLPHGVKIELQNKKLWRQFHAESTEMII
TKLGRRMFPAVQLNVSGLESRARYCLLLEIAPASRRRHKYVGASGENSST
PGTTRGWTSAGPAEPQPRINRRVYLHPDSPATGHHWMQHPVSFGKLKLTN
NAVDHHNNVVLTSMHKYIPRIWIIRCDDLANMNNLYSQPSASFTFDETEF
IAVTAYQNENITKLKINNNPFAKGFRETGQSRCKRKLHQMNERSESSAED
RSACEEEEENASSSESESHRPRRSSESEGNRPRRALSEAGSLDDSGVSSS
GGSTPPLAHSPGNYTRSPLRTQENERRSESAQQPARLHRPWADSSSPTQH
IHHRVQESPLAAPSATHPALDFHLFNPFLLPSSHQHHLAALEIARFQHQM
QQHRYASQHLAKFYR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR001699TF_T-box
IPR036960T-box_sf
IPR018186TF_T-box_CS
IPR008967p53-like_TF_DNA-bd