Homology
The following BLAST results are available for this feature:
BLAST of AE3019660-RA vs. genbank:protein
Analysis Date: 2017-01-27 (
Blastp: Annotation v3.0 vs NR )
Total hits: 0
H A H T Y Y K K T W F F H Q W R H K K F L D T G I E H S I I D I R A L R G V N I S S V M R L G I N L N 5 10 15 20 25 30 35 40 45 50 Sequence
Match Name E-value Identity Description
back to top
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence
>AE3019660-PA ID=AE3019660-PA|Name=AE3019660-RA|organism=Aphidius ervi|type=polypeptide|length=51bp HAHTYYKKTWFFHQWRHKKFLDTGIEHSIIDIRALRGVNISSVMRLGINL N back to top