AE3000774-RA (mRNA) Aphidius ervi
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >AE3000774-RA ID=AE3000774-RA|Name=AE3000774-RA|organism=Aphidius ervi|type=mRNA|length=168bpback to top spliced messenger RNA >AE3000774-RA ID=AE3000774-RA|Name=AE3000774-RA|organism=Aphidius ervi|type=mRNA|length=168bp|location=Sequence derived from alignment at scaffold7:200625..200879- (Aphidius ervi)|Notes=Excludes all bases but those of type(s): exon. AAGATAGAAGAGGGCTGTTTTAACAGGATAATAGAACAAGAAAAGAGAGGback to top protein sequence of AE3000774-RA >AE3000774-PA ID=AE3000774-PA|Name=AE3000774-RA|organism=Aphidius ervi|type=polypeptide|length=55bp KIEEGCFNRIIEQEKRGLFYQGYRTGKEVFFESTSSAPSIYFFGNYRVNTback to top mRNA from alignment at scaffold7:200625..200879- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>AE3000774-RA ID=AE3000774-RA|Name=AE3000774-RA|organism=Aphidius ervi|type=mRNA|length=255bp|location=Sequence derived from alignment at scaffold7:200625..200879- (Aphidius ervi)back to top Coding sequence (CDS) from alignment at scaffold7:200625..200879- >AE3000774-RA ID=AE3000774-RA|Name=AE3000774-RA|organism=Aphidius ervi|type=CDS|length=168bp|location=Sequence derived from alignment at scaffold7:200625..200879- (Aphidius ervi)back to top Synonyms
The feature 'AE3000774-RA' has the following synonyms
|