Cotesia_sesamiae011750-PA (polypeptide) Cotesia sesamiae kitale
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of Cotesia_sesamiae011750-RA vs. genbank:protein
Match: gi|795067201|ref|XP_011874574.1| (PREDICTED: THAP domain-containing protein 2-like [Vollenhovia emeryi]) HSP 1 Score: 63.1586 bits (152), Expect = 3.050e-9 Identity = 31/79 (39.24%), Postives = 42/79 (53.16%), Query Frame = 0 Query: 1 MTGCSVSGCYNSMKNGCAMKILPRKNVPREKWIKSISRSKWSPDEYTYCVCEEHYSAYKAVTLCCDGKQDFDSCAVSTI 79 MTGC+ GC NS K G MKI PR R +W ++ R W+P + ++ +CE H+S DGK+ AV TI Sbjct: 1 MTGCTAPGCTNSDKKGFVMKIFPRDPTRRAQWAANVGREGWTPTDRSF-LCEVHFSYDMWENKRTDGKRKLKGNAVPTI 78
BLAST of Cotesia_sesamiae011750-RA vs. genbank:protein
Match: gi|998495421|ref|XP_015523373.1| (PREDICTED: THAP domain-containing protein 2-like [Neodiprion lecontei] >gi|998495423|ref|XP_015523374.1| PREDICTED: THAP domain-containing protein 2-like [Neodiprion lecontei]) HSP 1 Score: 61.6178 bits (148), Expect = 5.889e-9 Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 0 Query: 1 MTGCSVSGCYNSMKNGCAMKILPRKNVPREKWIKSISRSKWSPDEYTYCVCEEHYSAYKAVTLCCDGKQDFDSCAVSTIEP 81 M GCSV GC+NS G +MK P R +W K I R W P+ T C+CE H+ + DGK+ AV T+ P Sbjct: 1 MPGCSVPGCHNSSAKGYSMKSFPTNLARRLEWAKMIDRKNWIPN-RTSCICEVHFPPFMWEKPRVDGKRKLRHNAVPTMFP 80
BLAST of Cotesia_sesamiae011750-RA vs. genbank:protein
Match: gi|752887489|ref|XP_011261621.1| (PREDICTED: THAP domain-containing protein 2 [Camponotus floridanus] >gi|307174005|gb|EFN64715.1| THAP domain-containing protein 11 [Camponotus floridanus]) HSP 1 Score: 61.6178 bits (148), Expect = 6.311e-9 Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 0 Query: 1 MTGCSVSGCYNSMKNGCAMKILPRKNVPREKWIKSISRSKWSPDEYTYCVCEEHYSAYKAVTLCCDGKQDFDSCAVSTIEPQPNSSTANNKVFIFTIYYLYISTISEQNFVSFRTQLDF 119 M GC V GC NS G +M+ P + WI +I + W P ++ +CE H+S + CDGKQ AV TI P S +K +F + + + I N ++ + ++ Sbjct: 1 MPGCCVPGCSNSTAKGFSMRSFPADPERKALWIANIGKPNWEPKSHSR-ICEIHFSKDMWEKVRCDGKQKLKCNAVPTIFP----SRQQDKSILFNNHNTHENDIDSDNLINDKNNINL 114 The following BLAST results are available for this feature:
BLAST of Cotesia_sesamiae011750-RA vs. genbank:protein
Analysis Date: 2017-10-27 (Cotesia sesamiae OGS 1.0 Blast NR) Total hits: 3 ZOOMx 1POSITION0
BLAST of Cotesia_sesamiae011750-RA vs. GenBank_protein
Analysis Date: 2019-06-19 (Cotesia sesamiae OGS 1.1 Blast NR) Total hits: 0 ZOOMx 1POSITION0
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: Cotesia sesamiae OGS 1.0 InterProScan
Date Performed: 2017-10-27 ZOOMx 1POSITION0
Analysis Name: Cotesia sesamiae OGS1.1 InterProScan Date Performed: 2019-06-19 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Cotesia_sesamiae011750-PA ID=Cotesia_sesamiae011750-PA|Name=Cotesia_sesamiae011750-RA|organism=Cotesia sesamiae kitale|type=polypeptide|length=120bpback to top |