GSSPFG00011982001-RA (mRNA) Spodoptera frugiperda corn
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >GSSPFG00011982001-RA ID=GSSPFG00011982001-RA|Name=GSSPFG00011982001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=1926bp|location=Sequence derived from alignment at scaffold_649:90315..101209- (Spodoptera frugiperda corn)|Notes=Excludes all bases but those of type(s): exon. ATGATCGGAAGTGATTATACTTTGGAGTTGTGTAATGTTTTCCATTCTGGback to top protein sequence of GSSPFG00011982001-RA >GSSPFG00011982001-PA ID=GSSPFG00011982001-PA|Name=GSSPFG00011982001-RA|organism=Spodoptera frugiperda corn|type=polypeptide|length=642bp MIGSDYTLELCNVFHSGQVEPGSFFQRLTGGVKTGVILKDVSFTTHSGEVback to top mRNA from alignment at scaffold_649:90315..101209- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>GSSPFG00011982001-RA ID=GSSPFG00011982001-RA|Name=GSSPFG00011982001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=10895bp|location=Sequence derived from alignment at scaffold_649:90315..101209- (Spodoptera frugiperda corn)back to top Coding sequence (CDS) from alignment at scaffold_649:90315..101209- >GSSPFG00011982001-RA ID=GSSPFG00011982001-RA|Name=GSSPFG00011982001-RA|organism=Spodoptera frugiperda corn|type=CDS|length=1926bp|location=Sequence derived from alignment at scaffold_649:90315..101209- (Spodoptera frugiperda corn)back to top Synonyms
The feature 'GSSPFG00011982001-RA' has the following synonyms
|