SFRICE002622-RA (mRNA) Spodoptera frugiperda rice
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >SFRICE002622-RA ID=SFRICE002622-RA|Name=SFRICE002622-RA|organism=Spodoptera frugiperda rice|type=mRNA|length=4320bp|location=Sequence derived from alignment at SFRU_RICE_016126:16373..28611- (Spodoptera frugiperda rice)|Notes=Excludes all bases but those of type(s): exon. ATATAGCTCACGATTAGACACCTAGTCGGATGGCAGGACTATTTAATATTback to top protein sequence of SFRICE002622-RA >SFRICE002622-PA ID=SFRICE002622-PA|Name=SFRICE002622-RA|organism=Spodoptera frugiperda rice|type=polypeptide|length=1349bp MDKSNKNTAANGDGGQRAGEPKERVRKKPNILSRIFVWWIFPVLITGNKRback to top mRNA from alignment at SFRU_RICE_016126:16373..28611- Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>SFRICE002622-RA ID=SFRICE002622-RA|Name=SFRICE002622-RA|organism=Spodoptera frugiperda rice|type=mRNA|length=12239bp|location=Sequence derived from alignment at SFRU_RICE_016126:16373..28611- (Spodoptera frugiperda rice)back to top Coding sequence (CDS) from alignment at SFRU_RICE_016126:16373..28611- >SFRICE002622-RA ID=SFRICE002622-RA|Name=SFRICE002622-RA|organism=Spodoptera frugiperda rice|type=CDS|length=4047bp|location=Sequence derived from alignment at SFRU_RICE_016126:16373..28611- (Spodoptera frugiperda rice)back to top Synonyms
The feature 'SFRICE002622-RA' has the following synonyms
Orthology
View orthology data for SFRICE002622-RA
|