GSSPFG00024146001-RA (mRNA) Spodoptera frugiperda corn
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >GSSPFG00024146001-RA ID=GSSPFG00024146001-RA|Name=GSSPFG00024146001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=2742bp|location=Sequence derived from alignment at scaffold_5454:914..7417- (Spodoptera frugiperda corn)|Notes=Excludes all bases but those of type(s): exon. ATGTCACAGTCGGCGCTAGGCCTTGGTGGAGAGCGGAGGTACTCCGTGCCback to top protein sequence of GSSPFG00024146001-RA >GSSPFG00024146001-PA ID=GSSPFG00024146001-PA|Name=GSSPFG00024146001-RA|organism=Spodoptera frugiperda corn|type=polypeptide|length=914bp MSQSALGLGGERRYSVPSNPLMHDHRGMHSEDLHAWSIYRQNLNSDFTDSback to top mRNA from alignment at scaffold_5454:914..7417- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>GSSPFG00024146001-RA ID=GSSPFG00024146001-RA|Name=GSSPFG00024146001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=6504bp|location=Sequence derived from alignment at scaffold_5454:914..7417- (Spodoptera frugiperda corn)back to top Coding sequence (CDS) from alignment at scaffold_5454:914..7417- >GSSPFG00024146001-RA ID=GSSPFG00024146001-RA|Name=GSSPFG00024146001-RA|organism=Spodoptera frugiperda corn|type=CDS|length=2742bp|location=Sequence derived from alignment at scaffold_5454:914..7417- (Spodoptera frugiperda corn)back to top Synonyms
The feature 'GSSPFG00024146001-RA' has the following synonyms
|