GSSPFG00019825001-RA (mRNA) Spodoptera frugiperda corn
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >GSSPFG00019825001-RA ID=GSSPFG00019825001-RA|Name=GSSPFG00019825001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=2137bp|location=Sequence derived from alignment at scaffold_1237:1464..24135- (Spodoptera frugiperda corn)|Notes=Excludes all bases but those of type(s): exon. TTTTAACGCAATAAACGGGGAAGTGTAACTGTGTAATGAGTGTCTGGTGCback to top protein sequence of GSSPFG00019825001-RA >GSSPFG00019825001-PA ID=GSSPFG00019825001-PA|Name=GSSPFG00019825001-RA|organism=Spodoptera frugiperda corn|type=polypeptide|length=668bp MAPNFSKITSRTDVKIALAASAALSAWVIRNSLKSSKHKNVKSNRLSPEEback to top mRNA from alignment at scaffold_1237:1464..24135- Legend: exonUTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>GSSPFG00019825001-RA ID=GSSPFG00019825001-RA|Name=GSSPFG00019825001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=22672bp|location=Sequence derived from alignment at scaffold_1237:1464..24135- (Spodoptera frugiperda corn)back to top Coding sequence (CDS) from alignment at scaffold_1237:1464..24135- >GSSPFG00019825001-RA ID=GSSPFG00019825001-RA|Name=GSSPFG00019825001-RA|organism=Spodoptera frugiperda corn|type=CDS|length=2004bp|location=Sequence derived from alignment at scaffold_1237:1464..24135- (Spodoptera frugiperda corn)back to top Synonyms
The feature 'GSSPFG00019825001-RA' has the following synonyms
|