GSSPFG00022368001-RA (mRNA) Spodoptera frugiperda corn
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >GSSPFG00022368001-RA ID=GSSPFG00022368001-RA|Name=GSSPFG00022368001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=3228bp|location=Sequence derived from alignment at scaffold_176:104689..121872+ (Spodoptera frugiperda corn)|Notes=Excludes all bases but those of type(s): exon. ATGATAGTGAAGCTGAAGGAGGACCGCACCATCCTGCTGACCACGCACCAback to top protein sequence of GSSPFG00022368001-RA >GSSPFG00022368001-PA ID=GSSPFG00022368001-PA|Name=GSSPFG00022368001-RA|organism=Spodoptera frugiperda corn|type=polypeptide|length=1076bp MIVKLKEDRTILLTTHHLDEAELLSDQIVIMHKGQIHTTGSPIEIKRTLGback to top mRNA from alignment at scaffold_176:104689..121872+ Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>GSSPFG00022368001-RA ID=GSSPFG00022368001-RA|Name=GSSPFG00022368001-RA|organism=Spodoptera frugiperda corn|type=mRNA|length=17184bp|location=Sequence derived from alignment at scaffold_176:104689..121872+ (Spodoptera frugiperda corn)back to top Coding sequence (CDS) from alignment at scaffold_176:104689..121872+ >GSSPFG00022368001-RA ID=GSSPFG00022368001-RA|Name=GSSPFG00022368001-RA|organism=Spodoptera frugiperda corn|type=CDS|length=3228bp|location=Sequence derived from alignment at scaffold_176:104689..121872+ (Spodoptera frugiperda corn)back to top Synonyms
The feature 'GSSPFG00022368001-RA' has the following synonyms
|