g3954.t1 (mRNA) Venturia canescens
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following stop_codon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >g3954.t1 ID=g3954.t1|Name=g3954.t1|organism=Venturia canescens|type=mRNA|length=381bp|location=Sequence derived from alignment at scaffold_13228:275..655- (Venturia canescens)|Notes=Excludes all bases but those of type(s): exon. ATGCTAAGTATACGCGTTAAGATAGATGCCGCAGATTATAAAAAGACAGGback to top protein sequence of g3954.t1 >g3954.t1-PA ID=g3954.t1-PA|Name=g3954.t1|organism=Venturia canescens|type=polypeptide|length=126bp MLSIRVKIDAADYKKTGGLEGVSPDVGPVNNLLHSMFSQIDVFLNQKLVSback to top mRNA from alignment at scaffold_13228:275..655- Legend: polypeptideCDSexonstart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>g3954.t1 ID=g3954.t1|Name=g3954.t1|organism=Venturia canescens|type=mRNA|length=381bp|location=Sequence derived from alignment at scaffold_13228:275..655- (Venturia canescens)back to top Coding sequence (CDS) from alignment at scaffold_13228:275..655- >g3954.t1 ID=g3954.t1|Name=g3954.t1|organism=Venturia canescens|type=CDS|length=381bp|location=Sequence derived from alignment at scaffold_13228:275..655- (Venturia canescens)back to top Orthology
View orthology data for g3954.t1
|