AG6000638-RA (mRNA) Aphis glycines Ag_bt1
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >AG6000638-RA ID=AG6000638-RA|Name=AG6000638-RA|organism=Aphis glycines Ag_bt1|type=mRNA|length=342bp|location=Sequence derived from alignment at SBAphidCtg1001:4882332..4882855+ (Aphis glycines Ag_bt1)|Notes=Excludes all bases but those of type(s): exon. ATGAACAAGCAGTTGGCGCTGCGGAGCGACATCTTTTTTGGAGCTGATGAback to top protein sequence of AG6000638-RA >AG6000638-PA ID=AG6000638-PA|Name=AG6000638-RA|organism=Aphis glycines Ag_bt1|type=polypeptide|length=113bp MNKQLALRSDIFFGADDYQLERHTPPLTSTTHWIVSKTVTKQQHSRLALSback to top mRNA from alignment at SBAphidCtg1001:4882332..4882855+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>AG6000638-RA ID=AG6000638-RA|Name=AG6000638-RA|organism=Aphis glycines Ag_bt1|type=mRNA|length=524bp|location=Sequence derived from alignment at SBAphidCtg1001:4882332..4882855+ (Aphis glycines Ag_bt1)back to top Coding sequence (CDS) from alignment at SBAphidCtg1001:4882332..4882855+ >AG6000638-RA ID=AG6000638-RA|Name=AG6000638-RA|organism=Aphis glycines Ag_bt1|type=CDS|length=342bp|location=Sequence derived from alignment at SBAphidCtg1001:4882332..4882855+ (Aphis glycines Ag_bt1)back to top Synonyms
The feature 'AG6000638-RA' has the following synonyms
|