Cotesia_flavipes000167-RA (mRNA) Cotesia flavipes
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=mRNA|length=1793bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)|Notes=Excludes all bases but those of type(s): exon. CGCAAGTGTAAGTTTCTAATTCTCAAATTTGCAAAATCAACACGACACTTback to top protein sequence of Cotesia_flavipes000167-RA >Cotesia_flavipes000167-PA ID=Cotesia_flavipes000167-PA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=polypeptide|length=544bp MASAISSAVDSLHSAIQSNIIPNQEYLLQGSVLDTAVEVLLHRLRGLCDNback to top mRNA from alignment at scaffold_17:29815..38760+ Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=mRNA|length=8946bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)back to top Coding sequence (CDS) from alignment at scaffold_17:29815..38760+ >Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=CDS|length=1632bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)back to top Synonyms
The feature 'Cotesia_flavipes000167-RA' has the following synonyms
|