Cotesia_flavipes000167-RA (mRNA) Cotesia flavipes
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=mRNA|length=1793bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)|Notes=Excludes all bases but those of type(s): exon. CGCAAGTGTAAGTTTCTAATTCTCAAATTTGCAAAATCAACACGACACTTback to top protein sequence of Cotesia_flavipes000167-RA >Cotesia_flavipes000167-PA ID=Cotesia_flavipes000167-PA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=polypeptide|length=544bp MASAISSAVDSLHSAIQSNIIPNQEYLLQGSVLDTAVEVLLHRLRGLCDNback to top mRNA from alignment at scaffold_17:29815..38760+ Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=mRNA|length=8946bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)back to top Coding sequence (CDS) from alignment at scaffold_17:29815..38760+ >Cotesia_flavipes000167-RA ID=Cotesia_flavipes000167-RA|Name=Cotesia_flavipes000167-RA|organism=Cotesia flavipes|type=CDS|length=1632bp|location=Sequence derived from alignment at scaffold_17:29815..38760+ (Cotesia flavipes)back to top Synonyms
The feature 'Cotesia_flavipes000167-RA' has the following synonyms
|