Homology
The following BLAST results are available for this feature:
BLAST of Cotesia_vestalis002808-RA vs. genbank:protein
Analysis Date: 2017-10-27 ( Cotesia vestalis OGS 1.0 Blast NR)
Total hits: 0
| Match Name | E-value | Identity | Description | |
|---|
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
| Category |
Term Accession |
Term Name |
| molecular_function |
GO:0005515 |
protein binding |
| molecular_function |
GO:0008270 |
zinc ion binding |
InterPro
Analysis Name: Cotesia vestalis OGS 1.0 InterProScan
Date Performed: 2017-10-27
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR013083 | Zinc finger, RING/FYVE/PHD-type | GENE3D | 3.30.40.10 | | coord: 40..87
e-value: 1.9E-4
score: 20.1 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 25..110 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 6..24 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..5 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..10
score: 0.452 |
| None | No IPR available | SUPERFAMILY | 57850 | RING/U-box | coord: 33..90 |
| IPR001841 | Zinc finger, RING-type | PROSITE | PS50089 | ZF_RING_2 | coord: 45..84
score: 8.845 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Cotesia_vestalis002808-PA ID=Cotesia_vestalis002808-PA|Name=Cotesia_vestalis002808-RA|organism=Cotesia vestalis|type=polypeptide|length=111bp
MAVHWSELVFELSLYSSLLLYDYCKKKKKSKEEKNQKLNYQEKICAVCGK
KIKLNSKNHKLNCGHSCHKVCYQYQSKKECNICKIESIKDFEKLDFQVEE
IGLEKKLMSD. back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
| Term | Definition |
|---|
| GO:0005515 | protein binding |
| GO:0008270 | zinc ion binding |
|