DV3020610-RA (mRNA) Daktulosphaira vitifoliae
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >DV3020610-RA ID=DV3020610-RA|Name=DV3020610-RA|organism=Daktulosphaira vitifoliae|type=mRNA|length=402bp|location=Sequence derived from alignment at scaffold1527:16591..17994+ (Daktulosphaira vitifoliae)|Notes=Excludes all bases but those of type(s): exon. ATGGAAATTTGTAATTGTCATGTAATTTGTGATTCTCCAACTAAAAGCTTback to top protein sequence of DV3020610-RA >DV3020610-PA ID=DV3020610-PA|Name=DV3020610-RA|organism=Daktulosphaira vitifoliae|type=polypeptide|length=134bp MEICNCHVICDSPTKSFILNVKSYNAYFGCTSCTQEESPLRTNESFRSKTback to top mRNA from alignment at scaffold1527:16591..17994+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>DV3020610-RA ID=DV3020610-RA|Name=DV3020610-RA|organism=Daktulosphaira vitifoliae|type=mRNA|length=1404bp|location=Sequence derived from alignment at scaffold1527:16591..17994+ (Daktulosphaira vitifoliae)back to top Coding sequence (CDS) from alignment at scaffold1527:16591..17994+ >DV3020610-RA ID=DV3020610-RA|Name=DV3020610-RA|organism=Daktulosphaira vitifoliae|type=CDS|length=402bp|location=Sequence derived from alignment at scaffold1527:16591..17994+ (Daktulosphaira vitifoliae)back to top Synonyms
The feature 'DV3020610-RA' has the following synonyms
Metabolic Data
View metabolic data for DV3020610-RA on AphidCyc
|