AG6000668-RA (mRNA) Aphis glycines Ag_bt1
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >AG6000668-RA ID=AG6000668-RA|Name=AG6000668-RA|organism=Aphis glycines Ag_bt1|type=mRNA|length=237bp|location=Sequence derived from alignment at SBAphidCtg1001:4970085..4970601+ (Aphis glycines Ag_bt1)|Notes=Excludes all bases but those of type(s): exon. ATGATTATAATATCAAAAATTATTTTATTATTGCAACTATCCTACACGCTback to top protein sequence of AG6000668-RA >AG6000668-PA ID=AG6000668-PA|Name=AG6000668-RA|organism=Aphis glycines Ag_bt1|type=polypeptide|length=78bp MIIISKIILLLQLSYTLHQILQLLALEQFHSLNLVLDHLHSEEVLNINILback to top mRNA from alignment at SBAphidCtg1001:4970085..4970601+ Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>AG6000668-RA ID=AG6000668-RA|Name=AG6000668-RA|organism=Aphis glycines Ag_bt1|type=mRNA|length=517bp|location=Sequence derived from alignment at SBAphidCtg1001:4970085..4970601+ (Aphis glycines Ag_bt1)back to top Coding sequence (CDS) from alignment at SBAphidCtg1001:4970085..4970601+ >AG6000668-RA ID=AG6000668-RA|Name=AG6000668-RA|organism=Aphis glycines Ag_bt1|type=CDS|length=237bp|location=Sequence derived from alignment at SBAphidCtg1001:4970085..4970601+ (Aphis glycines Ag_bt1)back to top Synonyms
The feature 'AG6000668-RA' has the following synonyms
|